Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IAZ9

Protein Details
Accession A0A3N4IAZ9    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-52HVLEEGREKKKKRKKKKKLASKPHPSSKPNBasic
NLS Segment(s)
PositionSequence
29-70REKKKKRKKKKKLASKPHPSSKPNTREAIKKTWEEGKRRSRY
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MPLIDTGLAQRGKYFKLGANHQHVLEEGREKKKKRKKKKKLASKPHPSSKPNTREAIKKTWEEGKRRSRYNAKEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.27
4 0.35
5 0.4
6 0.45
7 0.46
8 0.44
9 0.42
10 0.38
11 0.33
12 0.27
13 0.26
14 0.24
15 0.31
16 0.37
17 0.4
18 0.5
19 0.59
20 0.68
21 0.72
22 0.78
23 0.8
24 0.86
25 0.93
26 0.94
27 0.95
28 0.96
29 0.95
30 0.95
31 0.93
32 0.91
33 0.88
34 0.79
35 0.76
36 0.74
37 0.71
38 0.65
39 0.62
40 0.56
41 0.56
42 0.59
43 0.6
44 0.55
45 0.5
46 0.48
47 0.52
48 0.55
49 0.55
50 0.59
51 0.62
52 0.65
53 0.68
54 0.74
55 0.75