Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IFV9

Protein Details
Accession A0A3N4IFV9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
95-129GDATKIEKASRQQRKQRKNKGKETRGTHKKVKKEKBasic
NLS Segment(s)
PositionSequence
102-129KASRQQRKQRKNKGKETRGTHKKVKKEK
Subcellular Location(s) mito 18.5, cyto_mito 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSEAVTLRTRKFIKNPLLARKQMVVDILHPNRPPVSKDEVRSKLAELYKADKAQVSVFGVRTAFGGGKSTGFALIYDSHEALKKFEPHYRLVRYGDATKIEKASRQQRKQRKNKGKETRGTHKKVKKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.67
3 0.69
4 0.74
5 0.71
6 0.66
7 0.6
8 0.52
9 0.44
10 0.38
11 0.28
12 0.24
13 0.31
14 0.31
15 0.32
16 0.31
17 0.31
18 0.31
19 0.32
20 0.3
21 0.25
22 0.31
23 0.31
24 0.36
25 0.44
26 0.46
27 0.47
28 0.46
29 0.43
30 0.4
31 0.37
32 0.35
33 0.28
34 0.27
35 0.29
36 0.28
37 0.27
38 0.22
39 0.21
40 0.18
41 0.18
42 0.15
43 0.13
44 0.12
45 0.13
46 0.12
47 0.11
48 0.11
49 0.09
50 0.08
51 0.06
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.09
63 0.1
64 0.1
65 0.1
66 0.12
67 0.13
68 0.13
69 0.16
70 0.19
71 0.2
72 0.25
73 0.27
74 0.3
75 0.37
76 0.4
77 0.41
78 0.39
79 0.39
80 0.38
81 0.38
82 0.36
83 0.33
84 0.31
85 0.28
86 0.29
87 0.27
88 0.28
89 0.33
90 0.41
91 0.47
92 0.54
93 0.63
94 0.7
95 0.81
96 0.88
97 0.91
98 0.92
99 0.92
100 0.93
101 0.94
102 0.93
103 0.92
104 0.9
105 0.9
106 0.89
107 0.86
108 0.86
109 0.82