Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HEJ7

Protein Details
Accession A0A3N4HEJ7   
Localization Confidence High
Confidence Score 23.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-48DADTVKRKSEKRVRRDKKKFRYLLNHPLLBasic
92-112QTSTRSRGKAPRKRARPADSDHydrophilic
127-153EGGPSSKKTKKTTPKKTTPKKKKPKTTBasic
NLS Segment(s)
PositionSequence
25-39KRKSEKRVRRDKKKF
80-108RKQKEEEAKKNRQTSTRSRGKAPRKRARP
132-152SKKTKKTTPKKTTPKKKKPKT
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences GSKDSAPDSDSDSDIASGDDADTVKRKSEKRVRRDKKKFRYLLNHPLLWDPVTLPDDENPHKVNLERGRAELAAAADAERKQKEEEAKKNRQTSTRSRGKAPRKRARPADSDEEEPDNDTDYEEDDEGGPSSKKTKKTTPKKTTPKKKKPKTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.1
4 0.07
5 0.07
6 0.07
7 0.07
8 0.09
9 0.12
10 0.13
11 0.18
12 0.24
13 0.27
14 0.36
15 0.46
16 0.55
17 0.61
18 0.72
19 0.78
20 0.84
21 0.92
22 0.93
23 0.93
24 0.94
25 0.9
26 0.88
27 0.87
28 0.84
29 0.84
30 0.79
31 0.7
32 0.59
33 0.54
34 0.46
35 0.36
36 0.28
37 0.17
38 0.13
39 0.13
40 0.12
41 0.11
42 0.12
43 0.16
44 0.18
45 0.2
46 0.19
47 0.18
48 0.18
49 0.18
50 0.24
51 0.24
52 0.28
53 0.26
54 0.26
55 0.27
56 0.26
57 0.26
58 0.19
59 0.14
60 0.09
61 0.08
62 0.07
63 0.06
64 0.07
65 0.1
66 0.09
67 0.1
68 0.1
69 0.14
70 0.22
71 0.29
72 0.39
73 0.46
74 0.55
75 0.61
76 0.67
77 0.67
78 0.65
79 0.62
80 0.61
81 0.62
82 0.62
83 0.57
84 0.58
85 0.64
86 0.69
87 0.72
88 0.74
89 0.74
90 0.73
91 0.8
92 0.83
93 0.8
94 0.76
95 0.73
96 0.71
97 0.65
98 0.6
99 0.53
100 0.46
101 0.4
102 0.34
103 0.28
104 0.21
105 0.17
106 0.14
107 0.12
108 0.11
109 0.12
110 0.11
111 0.11
112 0.09
113 0.1
114 0.1
115 0.12
116 0.11
117 0.1
118 0.17
119 0.22
120 0.29
121 0.35
122 0.45
123 0.54
124 0.65
125 0.76
126 0.8
127 0.85
128 0.89
129 0.94
130 0.95
131 0.96
132 0.96
133 0.96