Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HTQ6

Protein Details
Accession A0A3N4HTQ6    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-46NEQPHTTSERETRRRRDCKRCIGGSRPRKNKPNKNIWPPFPFHydrophilic
72-96TYENTEKNTVKRRKKVTPQHQCPCTHydrophilic
NLS Segment(s)
PositionSequence
30-35RPRKNK
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MPHKNEQPHTTSERETRRRRDCKRCIGGSRPRKNKPNKNIWPPFPFPPPTLHIAIPSPTPTYSPQPTNLQSTYENTEKNTVKRRKKVTPQHQCPCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.64
3 0.68
4 0.74
5 0.8
6 0.85
7 0.88
8 0.87
9 0.88
10 0.89
11 0.87
12 0.83
13 0.82
14 0.82
15 0.82
16 0.83
17 0.81
18 0.8
19 0.81
20 0.84
21 0.85
22 0.84
23 0.84
24 0.84
25 0.85
26 0.85
27 0.82
28 0.77
29 0.71
30 0.64
31 0.57
32 0.5
33 0.4
34 0.35
35 0.31
36 0.28
37 0.27
38 0.24
39 0.2
40 0.19
41 0.19
42 0.16
43 0.15
44 0.13
45 0.1
46 0.12
47 0.14
48 0.18
49 0.22
50 0.23
51 0.26
52 0.3
53 0.33
54 0.36
55 0.34
56 0.32
57 0.29
58 0.3
59 0.32
60 0.3
61 0.29
62 0.25
63 0.32
64 0.33
65 0.38
66 0.45
67 0.5
68 0.57
69 0.65
70 0.72
71 0.75
72 0.82
73 0.87
74 0.88
75 0.89
76 0.9