Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HYU5

Protein Details
Accession A0A3N4HYU5   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
92-123SHQPNILHFRRPRRRPTPRRIRQTKRSLQSTSHydrophilic
NLS Segment(s)
PositionSequence
101-117RRPRRRPTPRRIRQTKR
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MQLQPTTMHKRNLNKYIKINKPYMTNKRKPMQFHPSTPFPSFLPFPPTIPCTNASTVQSFHHLSMVYGIPPPSRSIPAPPPLHHHQKYSPPSHQPNILHFRRPRRRPTPRRIRQTKRSLQSTSTKRMSTDVERPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.77
4 0.8
5 0.76
6 0.72
7 0.65
8 0.65
9 0.68
10 0.69
11 0.69
12 0.68
13 0.71
14 0.75
15 0.77
16 0.74
17 0.73
18 0.72
19 0.69
20 0.68
21 0.65
22 0.63
23 0.62
24 0.58
25 0.5
26 0.4
27 0.37
28 0.31
29 0.26
30 0.26
31 0.22
32 0.21
33 0.22
34 0.25
35 0.23
36 0.23
37 0.23
38 0.2
39 0.21
40 0.23
41 0.22
42 0.2
43 0.2
44 0.19
45 0.2
46 0.18
47 0.16
48 0.15
49 0.13
50 0.12
51 0.13
52 0.12
53 0.09
54 0.09
55 0.09
56 0.08
57 0.09
58 0.1
59 0.09
60 0.11
61 0.11
62 0.15
63 0.2
64 0.27
65 0.3
66 0.3
67 0.36
68 0.4
69 0.49
70 0.47
71 0.45
72 0.42
73 0.48
74 0.54
75 0.54
76 0.54
77 0.53
78 0.57
79 0.56
80 0.58
81 0.51
82 0.52
83 0.54
84 0.51
85 0.51
86 0.5
87 0.59
88 0.63
89 0.68
90 0.7
91 0.72
92 0.81
93 0.83
94 0.89
95 0.9
96 0.9
97 0.93
98 0.94
99 0.93
100 0.92
101 0.92
102 0.91
103 0.89
104 0.86
105 0.79
106 0.73
107 0.74
108 0.71
109 0.69
110 0.65
111 0.57
112 0.51
113 0.5
114 0.5
115 0.47