Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HQP3

Protein Details
Accession A0A3N4HQP3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-98MLAKWIKTRTRRMIRAKFKREERIDPGHydrophilic
NLS Segment(s)
PositionSequence
81-91TRRMIRAKFKR
Subcellular Location(s) cyto_nucl 13, nucl 12.5, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
IPR039467  TFIIIB_B''_Myb  
Pfam View protein in Pfam  
PF15963  Myb_DNA-bind_7  
CDD cd00167  SANT  
Amino Acid Sequences MVDGKLSIDHSSTVVSRTTFDGSLLEANEEDERTRLVNSATYGKRQKSDRWGYEETEKFYEGLTKFGTDFEMLAKWIKTRTRRMIRAKFKREERIDPGRVTEALR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.16
5 0.18
6 0.16
7 0.16
8 0.14
9 0.14
10 0.15
11 0.14
12 0.12
13 0.1
14 0.11
15 0.11
16 0.11
17 0.1
18 0.08
19 0.09
20 0.09
21 0.09
22 0.09
23 0.08
24 0.1
25 0.11
26 0.19
27 0.2
28 0.26
29 0.3
30 0.31
31 0.35
32 0.36
33 0.39
34 0.41
35 0.49
36 0.47
37 0.49
38 0.49
39 0.47
40 0.52
41 0.49
42 0.41
43 0.34
44 0.3
45 0.23
46 0.2
47 0.24
48 0.16
49 0.16
50 0.14
51 0.13
52 0.13
53 0.13
54 0.14
55 0.09
56 0.09
57 0.08
58 0.08
59 0.08
60 0.1
61 0.1
62 0.1
63 0.14
64 0.2
65 0.26
66 0.35
67 0.45
68 0.54
69 0.63
70 0.73
71 0.79
72 0.85
73 0.89
74 0.89
75 0.87
76 0.86
77 0.87
78 0.83
79 0.8
80 0.77
81 0.76
82 0.73
83 0.65
84 0.6
85 0.53