Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HMP3

Protein Details
Accession A0A3N4HMP3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
169-189IRRRGGSGKRRAKKNSRRGTSBasic
NLS Segment(s)
PositionSequence
170-187RRRGGSGKRRAKKNSRRG
Subcellular Location(s) cyto 15, pero 6, nucl 5
Family & Domain DBs
Amino Acid Sequences MSYSLPGFNLSDPSLTIDGWKLFRDIGAVGSFDGSNDAVDGAEASAPKVDIDDGEKGGSKQDGKSPERFGWRKETFGFMRADDKEVALAAAQILPHISSSRALRNALTLGTLDNAVRWALAFSEDHDQFIKTAASLYPRLDKTVSCVFPLYTCAYRMTLLGLISEEEEIRRRGGSGKRRAKKNSRRGTSGQAQSTPKATATQTNKPEEPAEDIGEEEAPAVEVAAEEDVEEPNEYDAHVFCHVNDKKLAKKVRAYKQLGHTGVRMLGIVLPNNTFWLFWAGRKNKYMDQIDYLKSDSDGKDFLKNTVETADSHYDNNLPGTYLPMGEVTRCVRSRAFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.18
4 0.18
5 0.2
6 0.21
7 0.22
8 0.19
9 0.18
10 0.18
11 0.18
12 0.15
13 0.14
14 0.14
15 0.13
16 0.12
17 0.14
18 0.13
19 0.11
20 0.12
21 0.09
22 0.08
23 0.08
24 0.07
25 0.06
26 0.06
27 0.06
28 0.05
29 0.07
30 0.07
31 0.07
32 0.08
33 0.08
34 0.08
35 0.08
36 0.08
37 0.07
38 0.11
39 0.14
40 0.14
41 0.15
42 0.16
43 0.16
44 0.18
45 0.2
46 0.19
47 0.18
48 0.23
49 0.31
50 0.34
51 0.4
52 0.43
53 0.45
54 0.53
55 0.54
56 0.52
57 0.53
58 0.51
59 0.5
60 0.46
61 0.48
62 0.39
63 0.41
64 0.39
65 0.3
66 0.34
67 0.31
68 0.33
69 0.26
70 0.24
71 0.19
72 0.17
73 0.16
74 0.09
75 0.08
76 0.05
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.06
83 0.06
84 0.07
85 0.08
86 0.11
87 0.17
88 0.19
89 0.2
90 0.2
91 0.21
92 0.21
93 0.19
94 0.17
95 0.11
96 0.09
97 0.09
98 0.09
99 0.07
100 0.06
101 0.07
102 0.06
103 0.06
104 0.05
105 0.05
106 0.04
107 0.06
108 0.06
109 0.07
110 0.14
111 0.14
112 0.15
113 0.16
114 0.16
115 0.14
116 0.16
117 0.14
118 0.07
119 0.08
120 0.08
121 0.11
122 0.12
123 0.13
124 0.18
125 0.19
126 0.2
127 0.2
128 0.19
129 0.21
130 0.27
131 0.27
132 0.21
133 0.21
134 0.2
135 0.19
136 0.22
137 0.2
138 0.13
139 0.13
140 0.13
141 0.13
142 0.14
143 0.13
144 0.12
145 0.1
146 0.09
147 0.08
148 0.07
149 0.07
150 0.07
151 0.07
152 0.06
153 0.05
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.13
160 0.2
161 0.29
162 0.38
163 0.48
164 0.55
165 0.62
166 0.7
167 0.76
168 0.8
169 0.81
170 0.81
171 0.76
172 0.75
173 0.7
174 0.69
175 0.67
176 0.62
177 0.54
178 0.48
179 0.45
180 0.4
181 0.38
182 0.31
183 0.23
184 0.19
185 0.17
186 0.2
187 0.24
188 0.31
189 0.35
190 0.39
191 0.39
192 0.38
193 0.39
194 0.32
195 0.31
196 0.25
197 0.2
198 0.16
199 0.16
200 0.15
201 0.14
202 0.12
203 0.07
204 0.05
205 0.04
206 0.04
207 0.04
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.04
215 0.04
216 0.05
217 0.05
218 0.05
219 0.06
220 0.06
221 0.06
222 0.06
223 0.06
224 0.08
225 0.1
226 0.1
227 0.09
228 0.2
229 0.22
230 0.24
231 0.28
232 0.3
233 0.34
234 0.42
235 0.49
236 0.44
237 0.51
238 0.58
239 0.64
240 0.7
241 0.69
242 0.68
243 0.7
244 0.74
245 0.68
246 0.6
247 0.51
248 0.43
249 0.38
250 0.31
251 0.23
252 0.14
253 0.13
254 0.13
255 0.13
256 0.12
257 0.12
258 0.12
259 0.14
260 0.14
261 0.11
262 0.1
263 0.15
264 0.15
265 0.18
266 0.29
267 0.32
268 0.38
269 0.42
270 0.46
271 0.44
272 0.52
273 0.54
274 0.47
275 0.48
276 0.49
277 0.47
278 0.45
279 0.41
280 0.33
281 0.28
282 0.29
283 0.24
284 0.2
285 0.21
286 0.21
287 0.27
288 0.28
289 0.29
290 0.3
291 0.29
292 0.28
293 0.27
294 0.26
295 0.2
296 0.26
297 0.29
298 0.25
299 0.25
300 0.25
301 0.24
302 0.24
303 0.25
304 0.19
305 0.14
306 0.13
307 0.16
308 0.16
309 0.14
310 0.14
311 0.15
312 0.15
313 0.15
314 0.19
315 0.19
316 0.26
317 0.27
318 0.3