Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4IQQ4

Protein Details
Accession A0A3N4IQQ4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
163-182YTKVEREKKEKEEREREERABasic
NLS Segment(s)
PositionSequence
145-176VKGEKKKAATPRKEKEWVYTKVEREKKEKEER
196-209REREASRGRPKYRK
Subcellular Location(s) cyto 16, nucl 6.5, mito_nucl 6, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MPGYGHGSKMAWGAEILKYLGNRRVFRRVFLLIDAMVGINKKDVVMIEYLKTLGISFQVVVNKCDKIAPGELRERMEGVKRELERVGATNVLGEILGVSAEPKKKDRRKFGVDAFRWAVLKACGLENEEAVIKDLKVEIKVDKEVKGEKKKAATPRKEKEWVYTKVEREKKEKEEREREERALEEEEWEEEMEERREREASRGRPKYRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.14
5 0.16
6 0.19
7 0.26
8 0.31
9 0.34
10 0.38
11 0.48
12 0.46
13 0.48
14 0.49
15 0.46
16 0.41
17 0.38
18 0.35
19 0.24
20 0.23
21 0.21
22 0.15
23 0.12
24 0.1
25 0.08
26 0.07
27 0.07
28 0.07
29 0.07
30 0.07
31 0.08
32 0.11
33 0.12
34 0.12
35 0.13
36 0.13
37 0.12
38 0.12
39 0.1
40 0.08
41 0.07
42 0.06
43 0.06
44 0.09
45 0.13
46 0.14
47 0.16
48 0.18
49 0.18
50 0.17
51 0.18
52 0.16
53 0.14
54 0.19
55 0.21
56 0.23
57 0.29
58 0.31
59 0.32
60 0.32
61 0.29
62 0.25
63 0.27
64 0.24
65 0.22
66 0.25
67 0.24
68 0.26
69 0.25
70 0.25
71 0.2
72 0.19
73 0.18
74 0.12
75 0.11
76 0.09
77 0.09
78 0.07
79 0.06
80 0.04
81 0.03
82 0.03
83 0.02
84 0.02
85 0.03
86 0.05
87 0.08
88 0.09
89 0.14
90 0.24
91 0.32
92 0.4
93 0.49
94 0.55
95 0.61
96 0.66
97 0.7
98 0.71
99 0.64
100 0.62
101 0.53
102 0.46
103 0.39
104 0.32
105 0.25
106 0.15
107 0.14
108 0.1
109 0.09
110 0.08
111 0.1
112 0.1
113 0.09
114 0.1
115 0.09
116 0.09
117 0.09
118 0.09
119 0.07
120 0.07
121 0.08
122 0.09
123 0.09
124 0.1
125 0.11
126 0.13
127 0.19
128 0.2
129 0.21
130 0.23
131 0.29
132 0.37
133 0.44
134 0.46
135 0.45
136 0.49
137 0.53
138 0.61
139 0.64
140 0.66
141 0.67
142 0.71
143 0.75
144 0.77
145 0.72
146 0.71
147 0.69
148 0.65
149 0.62
150 0.6
151 0.58
152 0.6
153 0.66
154 0.63
155 0.61
156 0.63
157 0.65
158 0.69
159 0.73
160 0.73
161 0.77
162 0.8
163 0.81
164 0.79
165 0.72
166 0.64
167 0.57
168 0.5
169 0.43
170 0.35
171 0.29
172 0.24
173 0.22
174 0.2
175 0.18
176 0.15
177 0.12
178 0.16
179 0.17
180 0.19
181 0.19
182 0.2
183 0.23
184 0.24
185 0.32
186 0.38
187 0.44
188 0.53
189 0.62