Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4I274

Protein Details
Accession A0A3N4I274   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
65-102ERVKTEPKTKKELKKERKKQEKERRRMQRKAKPWFGFTBasic
NLS Segment(s)
PositionSequence
70-96EPKTKKELKKERKKQEKERRRMQRKAK
Subcellular Location(s) nucl 14.5, mito_nucl 13.666, mito 11.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MSQSSEKQQPPPYFPGTMQRPAASESAVVTTHTCNCPHCYMGLDTKTHDPSTASAQQYSTHPQLERVKTEPKTKKELKKERKKQEKERRRMQRKAKPWFGFTFSLFSWSIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.46
4 0.47
5 0.43
6 0.38
7 0.35
8 0.35
9 0.34
10 0.25
11 0.19
12 0.14
13 0.13
14 0.13
15 0.12
16 0.11
17 0.11
18 0.15
19 0.17
20 0.17
21 0.17
22 0.21
23 0.22
24 0.22
25 0.2
26 0.19
27 0.19
28 0.25
29 0.25
30 0.23
31 0.22
32 0.26
33 0.27
34 0.25
35 0.23
36 0.17
37 0.15
38 0.2
39 0.24
40 0.21
41 0.2
42 0.2
43 0.21
44 0.22
45 0.25
46 0.2
47 0.17
48 0.16
49 0.22
50 0.29
51 0.31
52 0.32
53 0.31
54 0.37
55 0.39
56 0.49
57 0.51
58 0.49
59 0.55
60 0.61
61 0.66
62 0.7
63 0.78
64 0.79
65 0.82
66 0.88
67 0.9
68 0.92
69 0.93
70 0.94
71 0.94
72 0.94
73 0.93
74 0.93
75 0.93
76 0.92
77 0.92
78 0.91
79 0.91
80 0.9
81 0.9
82 0.9
83 0.84
84 0.79
85 0.74
86 0.69
87 0.62
88 0.53
89 0.47
90 0.37
91 0.35