Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4IC48

Protein Details
Accession A0A3N4IC48    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
72-92RSPSRKSSRSNISRQRSKKTAHydrophilic
242-265ASRTGSSRDKKRLHSRQMSRSDMVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001398  Macrophage_inhib_fac  
IPR014347  Tautomerase/MIF_sf  
Pfam View protein in Pfam  
PF01187  MIF  
Amino Acid Sequences MGSLPHHRNTPSALSNAPASKVAQLIGRAPPSPAPTNSFEEDYLNSPNSGRPHINDIMREVERDTPGGPMDRSPSRKSSRSNISRQRSKKTAMFYADAFAFRDAGVPVPSIAPVLVELKTNVILEDEFNFTKQLSAVFAKRFSRGEDTVGISVNHSCCMILGGTYDGAYFLTITSLSSISPTCNKRNAALIAEWLNTNLGVAPERGYIRFVEPSVADYATAGSTILDMMEKDEMQRTGSRAASRTGSSRDKKRLHSRQMSRSDMVEEEAPPLPQDNFSRKSDDLALPSTTPKLNSKASKASLNGADGGKRKRGMFGLFSRRNKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.35
4 0.32
5 0.26
6 0.22
7 0.21
8 0.21
9 0.2
10 0.18
11 0.18
12 0.2
13 0.24
14 0.26
15 0.25
16 0.25
17 0.28
18 0.3
19 0.34
20 0.32
21 0.32
22 0.34
23 0.39
24 0.4
25 0.39
26 0.34
27 0.31
28 0.3
29 0.28
30 0.27
31 0.23
32 0.2
33 0.18
34 0.22
35 0.22
36 0.25
37 0.25
38 0.24
39 0.3
40 0.35
41 0.38
42 0.36
43 0.35
44 0.37
45 0.35
46 0.34
47 0.28
48 0.27
49 0.25
50 0.24
51 0.21
52 0.16
53 0.17
54 0.19
55 0.18
56 0.15
57 0.19
58 0.26
59 0.31
60 0.33
61 0.4
62 0.43
63 0.49
64 0.52
65 0.56
66 0.6
67 0.63
68 0.7
69 0.72
70 0.76
71 0.8
72 0.81
73 0.8
74 0.75
75 0.71
76 0.65
77 0.61
78 0.58
79 0.52
80 0.48
81 0.4
82 0.37
83 0.33
84 0.29
85 0.24
86 0.17
87 0.13
88 0.11
89 0.11
90 0.09
91 0.09
92 0.09
93 0.08
94 0.08
95 0.08
96 0.08
97 0.07
98 0.07
99 0.05
100 0.05
101 0.07
102 0.07
103 0.07
104 0.07
105 0.08
106 0.09
107 0.09
108 0.08
109 0.07
110 0.07
111 0.07
112 0.09
113 0.11
114 0.1
115 0.11
116 0.11
117 0.1
118 0.1
119 0.1
120 0.09
121 0.08
122 0.11
123 0.13
124 0.15
125 0.19
126 0.2
127 0.22
128 0.22
129 0.22
130 0.25
131 0.23
132 0.23
133 0.22
134 0.22
135 0.21
136 0.21
137 0.18
138 0.13
139 0.14
140 0.12
141 0.1
142 0.08
143 0.07
144 0.06
145 0.07
146 0.06
147 0.04
148 0.04
149 0.05
150 0.05
151 0.05
152 0.05
153 0.04
154 0.04
155 0.04
156 0.04
157 0.03
158 0.03
159 0.03
160 0.03
161 0.04
162 0.05
163 0.04
164 0.05
165 0.06
166 0.07
167 0.13
168 0.17
169 0.2
170 0.25
171 0.26
172 0.26
173 0.31
174 0.31
175 0.27
176 0.24
177 0.23
178 0.2
179 0.2
180 0.18
181 0.14
182 0.12
183 0.09
184 0.09
185 0.06
186 0.05
187 0.05
188 0.06
189 0.06
190 0.09
191 0.1
192 0.1
193 0.11
194 0.11
195 0.13
196 0.14
197 0.13
198 0.13
199 0.12
200 0.14
201 0.15
202 0.14
203 0.11
204 0.1
205 0.1
206 0.08
207 0.08
208 0.06
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.05
216 0.06
217 0.06
218 0.07
219 0.1
220 0.11
221 0.12
222 0.15
223 0.15
224 0.18
225 0.22
226 0.24
227 0.22
228 0.24
229 0.25
230 0.25
231 0.27
232 0.29
233 0.35
234 0.4
235 0.47
236 0.55
237 0.58
238 0.66
239 0.74
240 0.78
241 0.79
242 0.83
243 0.83
244 0.83
245 0.86
246 0.83
247 0.73
248 0.64
249 0.56
250 0.46
251 0.38
252 0.3
253 0.22
254 0.19
255 0.18
256 0.17
257 0.14
258 0.15
259 0.14
260 0.16
261 0.21
262 0.25
263 0.29
264 0.31
265 0.37
266 0.35
267 0.38
268 0.4
269 0.39
270 0.35
271 0.33
272 0.33
273 0.29
274 0.3
275 0.3
276 0.25
277 0.25
278 0.25
279 0.27
280 0.33
281 0.38
282 0.43
283 0.49
284 0.51
285 0.54
286 0.52
287 0.52
288 0.48
289 0.43
290 0.41
291 0.34
292 0.36
293 0.36
294 0.39
295 0.39
296 0.4
297 0.39
298 0.39
299 0.43
300 0.43
301 0.44
302 0.49
303 0.54
304 0.6