Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4I4B3

Protein Details
Accession A0A3N4I4B3   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
146-179EQPVHRPKRHHTPHTPYPPRRFRPRGQGKKKKKDBasic
NLS Segment(s)
PositionSequence
151-179RPKRHHTPHTPYPPRRFRPRGQGKKKKKD
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MDEQHPHHGEGYDNFEPDQHQYDDDYQPPPDYSITKNSSDFLLSLFKTTTDAIEKTPQQSEAILEMAQRFANVGCNHHYRMNGLATKGIFNPPPDLPPTTTSTTLPQPSPRIPPARRLEALAPPRQTSHRPLEPVEGGRRLEDLIEQPVHRPKRHHTPHTPYPPRRFRPRGQGKKKKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.25
4 0.25
5 0.27
6 0.19
7 0.18
8 0.2
9 0.25
10 0.28
11 0.29
12 0.29
13 0.25
14 0.25
15 0.25
16 0.23
17 0.21
18 0.19
19 0.19
20 0.26
21 0.29
22 0.3
23 0.3
24 0.3
25 0.28
26 0.27
27 0.24
28 0.17
29 0.18
30 0.15
31 0.15
32 0.15
33 0.14
34 0.14
35 0.14
36 0.14
37 0.13
38 0.14
39 0.15
40 0.2
41 0.22
42 0.23
43 0.25
44 0.24
45 0.2
46 0.2
47 0.19
48 0.14
49 0.13
50 0.11
51 0.1
52 0.09
53 0.1
54 0.09
55 0.08
56 0.07
57 0.06
58 0.12
59 0.12
60 0.14
61 0.17
62 0.2
63 0.22
64 0.24
65 0.24
66 0.18
67 0.2
68 0.23
69 0.2
70 0.17
71 0.18
72 0.16
73 0.16
74 0.16
75 0.16
76 0.13
77 0.12
78 0.14
79 0.13
80 0.14
81 0.15
82 0.16
83 0.16
84 0.17
85 0.21
86 0.21
87 0.21
88 0.21
89 0.21
90 0.24
91 0.24
92 0.23
93 0.22
94 0.23
95 0.25
96 0.29
97 0.32
98 0.37
99 0.36
100 0.44
101 0.47
102 0.49
103 0.47
104 0.45
105 0.43
106 0.42
107 0.47
108 0.44
109 0.4
110 0.34
111 0.36
112 0.36
113 0.36
114 0.34
115 0.36
116 0.36
117 0.37
118 0.38
119 0.41
120 0.41
121 0.43
122 0.42
123 0.37
124 0.32
125 0.3
126 0.29
127 0.24
128 0.2
129 0.17
130 0.15
131 0.16
132 0.18
133 0.18
134 0.22
135 0.3
136 0.36
137 0.38
138 0.4
139 0.42
140 0.51
141 0.61
142 0.67
143 0.69
144 0.72
145 0.8
146 0.86
147 0.9
148 0.88
149 0.88
150 0.89
151 0.87
152 0.88
153 0.86
154 0.82
155 0.83
156 0.85
157 0.86
158 0.87
159 0.89