Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IFK2

Protein Details
Accession A0A3N4IFK2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
287-306SIWMKKYRWAPIKSRKIVYNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036909  Cyt_c-like_dom_sf  
IPR002326  Cyt_c1  
IPR021157  Cyt_c1_TM_anchor_C  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0009055  F:electron transfer activity  
GO:0020037  F:heme binding  
Pfam View protein in Pfam  
PF02167  Cytochrom_C1  
Amino Acid Sequences MLSRSCLRAVPALKTVGRRAASTASSAEAAAGKRLTRAGVLSTAVAAGSIAYYYGQYGPELHAATPAEEGLHPTKYPWKHEEALSTFDHQALRRGFQVYTEVCSSCHSLSRVPWRTLVGVSHTVDEVKAMAEEHEYDDDEPNDQGEIVKRPGKLSDPLPAPYPNDQAARAANQGALPPDLSLIVKGRHAGCNYIFSLLTGYPDEPPAGVTVPEGLNFNPYFPGTGIAMARVLFDGLVEYDDGTPATTSQMAKDVVEFLNWAAEPEMDVRKKMGMKVIMVTSVLIALSIWMKKYRWAPIKSRKIVYNPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.44
4 0.42
5 0.37
6 0.36
7 0.35
8 0.33
9 0.31
10 0.28
11 0.22
12 0.21
13 0.2
14 0.18
15 0.16
16 0.15
17 0.15
18 0.16
19 0.14
20 0.15
21 0.17
22 0.16
23 0.15
24 0.16
25 0.15
26 0.16
27 0.16
28 0.15
29 0.14
30 0.13
31 0.12
32 0.1
33 0.07
34 0.05
35 0.04
36 0.03
37 0.03
38 0.03
39 0.04
40 0.05
41 0.06
42 0.07
43 0.07
44 0.09
45 0.1
46 0.14
47 0.15
48 0.14
49 0.16
50 0.16
51 0.16
52 0.16
53 0.14
54 0.11
55 0.1
56 0.14
57 0.13
58 0.14
59 0.13
60 0.14
61 0.22
62 0.25
63 0.31
64 0.32
65 0.36
66 0.37
67 0.39
68 0.46
69 0.41
70 0.41
71 0.37
72 0.36
73 0.3
74 0.29
75 0.29
76 0.21
77 0.25
78 0.23
79 0.23
80 0.22
81 0.23
82 0.21
83 0.2
84 0.25
85 0.19
86 0.2
87 0.21
88 0.19
89 0.17
90 0.19
91 0.2
92 0.15
93 0.18
94 0.16
95 0.16
96 0.2
97 0.31
98 0.36
99 0.34
100 0.36
101 0.34
102 0.34
103 0.33
104 0.29
105 0.22
106 0.2
107 0.2
108 0.18
109 0.17
110 0.16
111 0.15
112 0.14
113 0.1
114 0.05
115 0.05
116 0.04
117 0.04
118 0.05
119 0.06
120 0.07
121 0.07
122 0.08
123 0.08
124 0.09
125 0.09
126 0.1
127 0.09
128 0.08
129 0.07
130 0.07
131 0.06
132 0.07
133 0.09
134 0.12
135 0.15
136 0.15
137 0.16
138 0.17
139 0.19
140 0.2
141 0.19
142 0.23
143 0.22
144 0.22
145 0.24
146 0.24
147 0.24
148 0.23
149 0.24
150 0.19
151 0.18
152 0.18
153 0.17
154 0.17
155 0.16
156 0.14
157 0.12
158 0.11
159 0.1
160 0.1
161 0.1
162 0.09
163 0.08
164 0.07
165 0.07
166 0.07
167 0.06
168 0.06
169 0.07
170 0.08
171 0.08
172 0.11
173 0.13
174 0.16
175 0.16
176 0.18
177 0.17
178 0.2
179 0.2
180 0.19
181 0.17
182 0.13
183 0.15
184 0.12
185 0.12
186 0.1
187 0.1
188 0.09
189 0.1
190 0.1
191 0.08
192 0.08
193 0.08
194 0.07
195 0.07
196 0.06
197 0.08
198 0.08
199 0.09
200 0.09
201 0.08
202 0.12
203 0.12
204 0.13
205 0.12
206 0.11
207 0.12
208 0.11
209 0.13
210 0.09
211 0.12
212 0.11
213 0.1
214 0.11
215 0.1
216 0.1
217 0.08
218 0.08
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.06
226 0.06
227 0.06
228 0.07
229 0.06
230 0.06
231 0.06
232 0.07
233 0.09
234 0.09
235 0.1
236 0.15
237 0.15
238 0.15
239 0.16
240 0.17
241 0.15
242 0.15
243 0.15
244 0.1
245 0.13
246 0.13
247 0.13
248 0.1
249 0.1
250 0.1
251 0.13
252 0.21
253 0.19
254 0.2
255 0.21
256 0.25
257 0.28
258 0.29
259 0.33
260 0.29
261 0.3
262 0.33
263 0.34
264 0.3
265 0.28
266 0.26
267 0.18
268 0.15
269 0.12
270 0.08
271 0.06
272 0.05
273 0.09
274 0.1
275 0.12
276 0.16
277 0.16
278 0.23
279 0.29
280 0.38
281 0.45
282 0.51
283 0.59
284 0.67
285 0.77
286 0.8
287 0.8
288 0.77
289 0.75