Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IDQ5

Protein Details
Accession A0A3N4IDQ5    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
206-225DENKPKPAKKKWKYGAAGKABasic
NLS Segment(s)
PositionSequence
209-230KPKPAKKKWKYGAAGKAGKAKP
Subcellular Location(s) cyto_nucl 14, nucl 13.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025602  BCP1_family  
Gene Ontology GO:0005634  C:nucleus  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF13862  BCCIP  
Amino Acid Sequences MSKRKASKNADSDVDMDSGSESIDEKIVDVDFELFDPNPTVDIQGIRNLLRQLFDNDAVLQDLSSLTELILSQPTVGTTVKVDGIESDPYAFLTVLNLRVHKDNDAVKQLVKYYIARAGGDQTEMGSFLKRAISGEERSEGDVGIVLAERLINMPVEIVPPMYKMLLEEVQWALEDKEPYNFSHFVIPSKTYTEVASTVSEDEEEDENKPKPAKKKWKYGAAGKAGKAKPAPSSQLFYFHPEDELWEKEGAGKTHNFKFIKLNESGSDSKRTFDEFGIMPRGSVTVISKDGFEKAVDAMAKAYKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.3
3 0.22
4 0.16
5 0.12
6 0.1
7 0.09
8 0.07
9 0.07
10 0.09
11 0.08
12 0.08
13 0.1
14 0.1
15 0.09
16 0.09
17 0.1
18 0.09
19 0.09
20 0.11
21 0.1
22 0.1
23 0.12
24 0.11
25 0.11
26 0.11
27 0.11
28 0.11
29 0.13
30 0.14
31 0.17
32 0.19
33 0.19
34 0.22
35 0.23
36 0.23
37 0.22
38 0.22
39 0.21
40 0.23
41 0.23
42 0.21
43 0.19
44 0.19
45 0.19
46 0.16
47 0.12
48 0.08
49 0.07
50 0.06
51 0.07
52 0.06
53 0.05
54 0.06
55 0.06
56 0.07
57 0.08
58 0.07
59 0.07
60 0.07
61 0.07
62 0.09
63 0.09
64 0.08
65 0.08
66 0.09
67 0.1
68 0.1
69 0.1
70 0.09
71 0.11
72 0.12
73 0.12
74 0.11
75 0.09
76 0.1
77 0.1
78 0.09
79 0.07
80 0.08
81 0.09
82 0.12
83 0.14
84 0.14
85 0.15
86 0.18
87 0.2
88 0.19
89 0.22
90 0.22
91 0.25
92 0.29
93 0.28
94 0.26
95 0.26
96 0.26
97 0.23
98 0.21
99 0.17
100 0.14
101 0.17
102 0.17
103 0.16
104 0.15
105 0.16
106 0.15
107 0.15
108 0.13
109 0.09
110 0.08
111 0.08
112 0.08
113 0.06
114 0.06
115 0.06
116 0.07
117 0.07
118 0.07
119 0.1
120 0.13
121 0.14
122 0.16
123 0.17
124 0.17
125 0.18
126 0.17
127 0.14
128 0.1
129 0.09
130 0.07
131 0.05
132 0.04
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.04
142 0.04
143 0.04
144 0.04
145 0.05
146 0.04
147 0.05
148 0.06
149 0.05
150 0.05
151 0.05
152 0.07
153 0.08
154 0.08
155 0.09
156 0.09
157 0.09
158 0.09
159 0.1
160 0.08
161 0.09
162 0.1
163 0.09
164 0.12
165 0.13
166 0.14
167 0.17
168 0.17
169 0.16
170 0.21
171 0.21
172 0.2
173 0.21
174 0.22
175 0.19
176 0.2
177 0.21
178 0.16
179 0.16
180 0.15
181 0.14
182 0.14
183 0.13
184 0.11
185 0.11
186 0.1
187 0.1
188 0.08
189 0.09
190 0.09
191 0.09
192 0.1
193 0.14
194 0.15
195 0.17
196 0.21
197 0.24
198 0.31
199 0.41
200 0.51
201 0.55
202 0.66
203 0.71
204 0.78
205 0.8
206 0.8
207 0.78
208 0.77
209 0.74
210 0.65
211 0.66
212 0.57
213 0.54
214 0.46
215 0.39
216 0.34
217 0.33
218 0.37
219 0.3
220 0.35
221 0.32
222 0.36
223 0.36
224 0.36
225 0.35
226 0.29
227 0.28
228 0.23
229 0.26
230 0.23
231 0.24
232 0.21
233 0.18
234 0.17
235 0.21
236 0.24
237 0.22
238 0.22
239 0.25
240 0.28
241 0.34
242 0.42
243 0.38
244 0.36
245 0.44
246 0.45
247 0.46
248 0.43
249 0.41
250 0.34
251 0.4
252 0.43
253 0.37
254 0.41
255 0.35
256 0.34
257 0.32
258 0.33
259 0.29
260 0.26
261 0.27
262 0.21
263 0.25
264 0.3
265 0.28
266 0.25
267 0.23
268 0.23
269 0.18
270 0.18
271 0.16
272 0.14
273 0.17
274 0.18
275 0.18
276 0.19
277 0.21
278 0.2
279 0.18
280 0.15
281 0.13
282 0.17
283 0.16
284 0.15
285 0.16