Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4I1M7

Protein Details
Accession A0A3N4I1M7    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKKATRKPTGPKKREGLABasic
NLS Segment(s)
PositionSequence
3-17KRKKATRKPTGPKKR
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKATRKPTGPKKREGLASSFACLFCNHENSVSCKIDRKAGIGGLDCKVCGQSFQTDINSLSAPIDVYSDWVDACDQVAKERERGGSPRRREREVDRSSPVGGGGGYDPRGADEDEDEDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.84
3 0.79
4 0.76
5 0.68
6 0.62
7 0.58
8 0.53
9 0.46
10 0.41
11 0.35
12 0.28
13 0.25
14 0.24
15 0.19
16 0.21
17 0.19
18 0.2
19 0.22
20 0.26
21 0.32
22 0.31
23 0.28
24 0.3
25 0.3
26 0.33
27 0.32
28 0.3
29 0.25
30 0.25
31 0.26
32 0.22
33 0.23
34 0.19
35 0.18
36 0.15
37 0.13
38 0.12
39 0.1
40 0.08
41 0.08
42 0.08
43 0.1
44 0.12
45 0.13
46 0.14
47 0.14
48 0.15
49 0.13
50 0.11
51 0.09
52 0.07
53 0.07
54 0.06
55 0.06
56 0.04
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.08
66 0.07
67 0.09
68 0.15
69 0.16
70 0.18
71 0.2
72 0.22
73 0.22
74 0.28
75 0.35
76 0.39
77 0.47
78 0.56
79 0.59
80 0.61
81 0.63
82 0.66
83 0.68
84 0.66
85 0.64
86 0.58
87 0.55
88 0.52
89 0.47
90 0.38
91 0.28
92 0.2
93 0.14
94 0.11
95 0.12
96 0.12
97 0.12
98 0.12
99 0.12
100 0.14
101 0.13
102 0.13
103 0.12