Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HWI4

Protein Details
Accession A0A3N4HWI4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-70YSLAKMRKRSRDRRDEERQESBasic
NLS Segment(s)
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, cyto 9.5, mito 3, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSPFLHLIPRSEDSTDEPKGENKKINKAVVATAGVISVLVLLFLIFSGIYSLAKMRKRSRDRRDEERQESMGKYDQKNGVGKGGVVVIERELGSDEVDIVDRVGKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.29
4 0.26
5 0.3
6 0.35
7 0.38
8 0.4
9 0.39
10 0.47
11 0.52
12 0.53
13 0.5
14 0.45
15 0.42
16 0.37
17 0.33
18 0.23
19 0.17
20 0.14
21 0.11
22 0.09
23 0.07
24 0.04
25 0.03
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.03
35 0.03
36 0.03
37 0.04
38 0.05
39 0.1
40 0.14
41 0.19
42 0.25
43 0.35
44 0.45
45 0.55
46 0.64
47 0.7
48 0.74
49 0.78
50 0.83
51 0.83
52 0.79
53 0.73
54 0.65
55 0.57
56 0.51
57 0.43
58 0.39
59 0.35
60 0.3
61 0.31
62 0.32
63 0.34
64 0.37
65 0.36
66 0.33
67 0.27
68 0.26
69 0.21
70 0.18
71 0.14
72 0.11
73 0.11
74 0.08
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.09
83 0.08
84 0.09
85 0.09
86 0.08