Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HX31

Protein Details
Accession A0A3N4HX31    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
96-122FYREPYRRFGRRHTYRSKCRYCKRIEFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, plas 4, E.R. 4, golg 4, mito 2
Family & Domain DBs
Amino Acid Sequences MYFHTFFIIITTFFALIVAAAAAPQHKYRYLDDDYLSSTHGQELQTLPQPDLAQLAAFDPTPPAFPSISHYIYDRNYRSLPEYRCRSNINNKPQRFYREPYRRFGRRHTYRSKCRYCKRIEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.06
4 0.06
5 0.05
6 0.03
7 0.03
8 0.04
9 0.05
10 0.07
11 0.09
12 0.11
13 0.14
14 0.17
15 0.19
16 0.25
17 0.28
18 0.3
19 0.29
20 0.29
21 0.28
22 0.25
23 0.24
24 0.18
25 0.14
26 0.12
27 0.13
28 0.11
29 0.11
30 0.12
31 0.14
32 0.18
33 0.19
34 0.18
35 0.18
36 0.18
37 0.17
38 0.16
39 0.13
40 0.08
41 0.07
42 0.07
43 0.06
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.12
54 0.16
55 0.18
56 0.17
57 0.18
58 0.19
59 0.22
60 0.28
61 0.25
62 0.23
63 0.23
64 0.23
65 0.27
66 0.32
67 0.34
68 0.37
69 0.41
70 0.42
71 0.45
72 0.48
73 0.5
74 0.54
75 0.58
76 0.61
77 0.65
78 0.63
79 0.66
80 0.67
81 0.69
82 0.64
83 0.61
84 0.61
85 0.62
86 0.64
87 0.67
88 0.71
89 0.71
90 0.7
91 0.73
92 0.73
93 0.72
94 0.78
95 0.8
96 0.81
97 0.84
98 0.9
99 0.91
100 0.91
101 0.91
102 0.91