Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HGS8

Protein Details
Accession A0A3N4HGS8    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
131-162AQRFHERPGLKRKRLRRERHRARFKEGFKRMVBasic
NLS Segment(s)
PositionSequence
133-160RFHERPGLKRKRLRRERHRARFKEGFKR
Subcellular Location(s) mito 18.5, cyto_mito 11, nucl 4, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MTWCLKTAALLRPTTGVFRNATAFAQLPRYFSQTPRTLIDEPGKFTERSSSYMNSILKDSDSRSHNRRSSAADRFGSDMISPMGINGNMQLPKMGPTAGRSIPVMNGDLSGAINQMKAAMSKNNVKHDWRAQRFHERPGLKRKRLRRERHRARFKEGFKRMVNVIIGMKAKGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.25
4 0.21
5 0.22
6 0.24
7 0.23
8 0.22
9 0.21
10 0.2
11 0.18
12 0.24
13 0.23
14 0.24
15 0.24
16 0.3
17 0.29
18 0.3
19 0.37
20 0.35
21 0.37
22 0.37
23 0.4
24 0.36
25 0.39
26 0.44
27 0.38
28 0.36
29 0.37
30 0.37
31 0.31
32 0.3
33 0.33
34 0.27
35 0.28
36 0.28
37 0.26
38 0.25
39 0.31
40 0.32
41 0.25
42 0.24
43 0.21
44 0.19
45 0.18
46 0.18
47 0.18
48 0.2
49 0.25
50 0.28
51 0.37
52 0.39
53 0.4
54 0.41
55 0.42
56 0.45
57 0.47
58 0.49
59 0.41
60 0.38
61 0.38
62 0.35
63 0.28
64 0.21
65 0.15
66 0.09
67 0.08
68 0.07
69 0.05
70 0.06
71 0.05
72 0.05
73 0.05
74 0.07
75 0.07
76 0.07
77 0.08
78 0.07
79 0.09
80 0.09
81 0.09
82 0.07
83 0.09
84 0.13
85 0.14
86 0.14
87 0.13
88 0.13
89 0.14
90 0.14
91 0.13
92 0.09
93 0.09
94 0.08
95 0.07
96 0.07
97 0.06
98 0.06
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.06
105 0.08
106 0.1
107 0.14
108 0.21
109 0.27
110 0.33
111 0.37
112 0.39
113 0.43
114 0.49
115 0.57
116 0.56
117 0.58
118 0.56
119 0.64
120 0.65
121 0.65
122 0.65
123 0.59
124 0.6
125 0.65
126 0.7
127 0.68
128 0.73
129 0.77
130 0.79
131 0.85
132 0.88
133 0.88
134 0.89
135 0.91
136 0.94
137 0.95
138 0.9
139 0.89
140 0.87
141 0.85
142 0.84
143 0.8
144 0.78
145 0.69
146 0.67
147 0.6
148 0.55
149 0.47
150 0.39
151 0.33
152 0.3
153 0.28