Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4IDB5

Protein Details
Accession A0A3N4IDB5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
11-38GLKGFLKRILKNKKGKKSKKETAAEETPHydrophilic
NLS Segment(s)
PositionSequence
16-30LKRILKNKKGKKSKK
Subcellular Location(s) mito 13.5, cyto 10, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MPGVPKGAIDGLKGFLKRILKNKKGKKSKKETAAEETPAAAVEAGQEAEAKPADAAAPTTPAPATEGAAAAPAAPVADKTETPSAAAPAEPPKIEEAPKIEEAPKVEETAPAAAPVAAGVPAALAAPATNETLPVENTTEKKVEEIPASAAVPQIQTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.27
4 0.32
5 0.4
6 0.48
7 0.54
8 0.64
9 0.73
10 0.8
11 0.84
12 0.89
13 0.9
14 0.9
15 0.9
16 0.9
17 0.88
18 0.83
19 0.8
20 0.76
21 0.68
22 0.57
23 0.48
24 0.38
25 0.29
26 0.23
27 0.14
28 0.08
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.07
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.07
43 0.05
44 0.08
45 0.08
46 0.08
47 0.08
48 0.08
49 0.09
50 0.09
51 0.09
52 0.07
53 0.07
54 0.06
55 0.07
56 0.06
57 0.05
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.04
64 0.05
65 0.05
66 0.08
67 0.1
68 0.1
69 0.11
70 0.11
71 0.1
72 0.1
73 0.1
74 0.09
75 0.1
76 0.12
77 0.11
78 0.11
79 0.13
80 0.14
81 0.15
82 0.15
83 0.15
84 0.18
85 0.2
86 0.21
87 0.2
88 0.2
89 0.21
90 0.24
91 0.21
92 0.19
93 0.18
94 0.17
95 0.17
96 0.17
97 0.16
98 0.11
99 0.11
100 0.08
101 0.08
102 0.07
103 0.06
104 0.04
105 0.04
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.02
113 0.04
114 0.05
115 0.07
116 0.06
117 0.07
118 0.08
119 0.1
120 0.11
121 0.12
122 0.14
123 0.16
124 0.18
125 0.21
126 0.23
127 0.21
128 0.22
129 0.24
130 0.25
131 0.24
132 0.24
133 0.23
134 0.24
135 0.25
136 0.23
137 0.21
138 0.18