Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4I5U3

Protein Details
Accession A0A3N4I5U3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-27GIAFGCRRNKSPKRKTYSTKDSHVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 12.333, cyto_nucl 9.666, mito 9
Family & Domain DBs
Amino Acid Sequences MPKGIAFGCRRNKSPKRKTYSTKDSHVVTHRSTNLAIRSLTMGERTGSRMIFNLWPYVTVFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.79
3 0.78
4 0.81
5 0.85
6 0.85
7 0.86
8 0.81
9 0.76
10 0.7
11 0.62
12 0.57
13 0.54
14 0.47
15 0.38
16 0.36
17 0.31
18 0.28
19 0.27
20 0.25
21 0.21
22 0.2
23 0.18
24 0.14
25 0.14
26 0.14
27 0.14
28 0.12
29 0.11
30 0.1
31 0.11
32 0.13
33 0.15
34 0.14
35 0.14
36 0.14
37 0.16
38 0.2
39 0.2
40 0.21
41 0.19
42 0.2