Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4IKY3

Protein Details
Accession A0A3N4IKY3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
371-399GVGKPPEEKKSPKIKKKKVVKEVVEDGKVBasic
NLS Segment(s)
PositionSequence
311-316RGRDRR
373-389GKPPEEKKSPKIKKKKV
Subcellular Location(s) nucl 14, cyto_nucl 13, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR004601  UvdE  
IPR036237  Xyl_isomerase-like_sf  
Gene Ontology GO:0004519  F:endonuclease activity  
GO:0006289  P:nucleotide-excision repair  
GO:0009411  P:response to UV  
Pfam View protein in Pfam  
PF03851  UvdE  
Amino Acid Sequences MEEEIALLDKELEEMDRAWEADVKGELFPDKEAMTTAFNSTDDPLPYTGRLGYACLNTHLRNADPPVFCSRTCRLATLNAADSSLEHAQQLGLQNAWDLVKLIEWNEAHNIKFMRISSEMFPFASHPDHVYDLNFAAEPLAKAGELAAKWGHRLTTHPGQFTQLASPRKEVIRAAIADLKYHNEMLTMLKLPPELDKDAVIILHMGGVFGDKPATISRFKETWPTLPAEVRRRIVLENDDVSYSVHDILPVCQELDIPLVLDWHHHNIIHDDSIREGTLDVLPLLPAIAETWKKRGIKQKMHYSEPVPGARGRDRRKHSEIVRFLPPGLGDVDLMVEAKGKERAVWGLMRRYGLGGWERKKGPDVVPVVIGVGKPPEEKKSPKIKKKKVVKEVVEDGKVVKEEVVEEVVETAIVDGQVVEEKALEDSEESEAALLDKELDEMEEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.13
4 0.13
5 0.13
6 0.17
7 0.16
8 0.18
9 0.2
10 0.19
11 0.17
12 0.19
13 0.19
14 0.16
15 0.17
16 0.16
17 0.14
18 0.13
19 0.14
20 0.15
21 0.16
22 0.16
23 0.17
24 0.16
25 0.16
26 0.17
27 0.18
28 0.21
29 0.19
30 0.2
31 0.2
32 0.2
33 0.21
34 0.21
35 0.19
36 0.17
37 0.16
38 0.16
39 0.18
40 0.2
41 0.21
42 0.23
43 0.27
44 0.26
45 0.3
46 0.3
47 0.27
48 0.28
49 0.32
50 0.36
51 0.32
52 0.35
53 0.39
54 0.39
55 0.38
56 0.4
57 0.38
58 0.38
59 0.38
60 0.37
61 0.31
62 0.35
63 0.39
64 0.38
65 0.39
66 0.31
67 0.3
68 0.27
69 0.25
70 0.24
71 0.21
72 0.16
73 0.12
74 0.11
75 0.11
76 0.14
77 0.16
78 0.13
79 0.12
80 0.11
81 0.11
82 0.13
83 0.13
84 0.1
85 0.08
86 0.07
87 0.08
88 0.09
89 0.09
90 0.13
91 0.13
92 0.15
93 0.2
94 0.22
95 0.21
96 0.25
97 0.25
98 0.2
99 0.23
100 0.22
101 0.2
102 0.2
103 0.22
104 0.2
105 0.23
106 0.23
107 0.21
108 0.21
109 0.17
110 0.18
111 0.17
112 0.15
113 0.13
114 0.14
115 0.15
116 0.16
117 0.15
118 0.14
119 0.13
120 0.13
121 0.12
122 0.09
123 0.08
124 0.09
125 0.08
126 0.07
127 0.07
128 0.06
129 0.06
130 0.06
131 0.09
132 0.08
133 0.09
134 0.11
135 0.11
136 0.12
137 0.13
138 0.13
139 0.1
140 0.14
141 0.19
142 0.27
143 0.3
144 0.31
145 0.31
146 0.32
147 0.33
148 0.31
149 0.28
150 0.26
151 0.27
152 0.27
153 0.28
154 0.28
155 0.28
156 0.29
157 0.24
158 0.2
159 0.2
160 0.2
161 0.2
162 0.22
163 0.21
164 0.2
165 0.2
166 0.2
167 0.16
168 0.15
169 0.13
170 0.09
171 0.09
172 0.1
173 0.11
174 0.11
175 0.1
176 0.1
177 0.11
178 0.11
179 0.12
180 0.14
181 0.13
182 0.12
183 0.12
184 0.12
185 0.12
186 0.11
187 0.09
188 0.06
189 0.05
190 0.05
191 0.04
192 0.04
193 0.03
194 0.04
195 0.04
196 0.04
197 0.04
198 0.03
199 0.04
200 0.05
201 0.08
202 0.1
203 0.11
204 0.15
205 0.15
206 0.16
207 0.22
208 0.23
209 0.23
210 0.24
211 0.24
212 0.22
213 0.25
214 0.29
215 0.3
216 0.33
217 0.3
218 0.29
219 0.28
220 0.27
221 0.27
222 0.24
223 0.2
224 0.17
225 0.17
226 0.17
227 0.15
228 0.15
229 0.12
230 0.1
231 0.08
232 0.06
233 0.06
234 0.07
235 0.07
236 0.09
237 0.09
238 0.08
239 0.07
240 0.07
241 0.07
242 0.08
243 0.07
244 0.05
245 0.05
246 0.05
247 0.05
248 0.07
249 0.08
250 0.1
251 0.11
252 0.11
253 0.12
254 0.14
255 0.15
256 0.16
257 0.16
258 0.13
259 0.13
260 0.13
261 0.13
262 0.11
263 0.09
264 0.08
265 0.08
266 0.08
267 0.07
268 0.06
269 0.06
270 0.05
271 0.05
272 0.04
273 0.03
274 0.03
275 0.07
276 0.1
277 0.12
278 0.16
279 0.22
280 0.23
281 0.29
282 0.39
283 0.46
284 0.53
285 0.61
286 0.68
287 0.68
288 0.72
289 0.71
290 0.62
291 0.59
292 0.54
293 0.46
294 0.37
295 0.32
296 0.31
297 0.35
298 0.42
299 0.43
300 0.47
301 0.52
302 0.59
303 0.63
304 0.68
305 0.68
306 0.69
307 0.69
308 0.64
309 0.63
310 0.55
311 0.49
312 0.42
313 0.35
314 0.26
315 0.2
316 0.15
317 0.09
318 0.08
319 0.08
320 0.07
321 0.07
322 0.06
323 0.07
324 0.06
325 0.08
326 0.11
327 0.11
328 0.11
329 0.13
330 0.15
331 0.16
332 0.21
333 0.24
334 0.29
335 0.31
336 0.31
337 0.3
338 0.29
339 0.26
340 0.25
341 0.27
342 0.29
343 0.3
344 0.36
345 0.38
346 0.38
347 0.41
348 0.42
349 0.37
350 0.37
351 0.37
352 0.31
353 0.31
354 0.29
355 0.27
356 0.23
357 0.21
358 0.13
359 0.11
360 0.11
361 0.13
362 0.16
363 0.21
364 0.27
365 0.32
366 0.41
367 0.51
368 0.6
369 0.68
370 0.77
371 0.82
372 0.86
373 0.91
374 0.93
375 0.92
376 0.92
377 0.88
378 0.85
379 0.84
380 0.81
381 0.72
382 0.61
383 0.52
384 0.44
385 0.38
386 0.29
387 0.2
388 0.13
389 0.12
390 0.14
391 0.14
392 0.11
393 0.11
394 0.11
395 0.1
396 0.09
397 0.08
398 0.06
399 0.06
400 0.05
401 0.05
402 0.05
403 0.05
404 0.08
405 0.08
406 0.08
407 0.08
408 0.09
409 0.09
410 0.1
411 0.09
412 0.07
413 0.09
414 0.11
415 0.11
416 0.11
417 0.1
418 0.1
419 0.1
420 0.1
421 0.08
422 0.07
423 0.07
424 0.08
425 0.08
426 0.08