Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4I3H4

Protein Details
Accession A0A3N4I3H4   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
183-211NSQRAAPYAKHPHRRRGPGKKNKSSYNDQHydrophilic
NLS Segment(s)
PositionSequence
192-205KHPHRRRGPGKKNK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MSSVDPDILYSSDLEGSPSTMAHSRPDPSIAPGSKQQTSPSFPDDHQQTYQSSAPYEEYSENDPSQHAVTLHHRSNDTLVELFKSCASAMKEDPVNASLLAQTAQSLVAMSGDHSYRMSGLVTKGLYQHPTGTAPQPALLSSRRDPLPEQQPPQTPPQQSTTHQRSLFDRIGPIRTVPQSSSNSQRAAPYAKHPHRRRGPGKKNKSSYNDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.11
5 0.11
6 0.12
7 0.13
8 0.14
9 0.17
10 0.2
11 0.21
12 0.22
13 0.25
14 0.24
15 0.25
16 0.33
17 0.31
18 0.31
19 0.35
20 0.38
21 0.38
22 0.38
23 0.39
24 0.36
25 0.39
26 0.39
27 0.37
28 0.35
29 0.32
30 0.39
31 0.38
32 0.37
33 0.34
34 0.32
35 0.29
36 0.3
37 0.32
38 0.25
39 0.22
40 0.19
41 0.19
42 0.17
43 0.19
44 0.16
45 0.15
46 0.18
47 0.21
48 0.2
49 0.18
50 0.18
51 0.17
52 0.16
53 0.15
54 0.12
55 0.12
56 0.18
57 0.24
58 0.26
59 0.28
60 0.27
61 0.26
62 0.28
63 0.26
64 0.21
65 0.16
66 0.13
67 0.13
68 0.13
69 0.13
70 0.11
71 0.1
72 0.09
73 0.12
74 0.13
75 0.13
76 0.13
77 0.16
78 0.17
79 0.17
80 0.18
81 0.14
82 0.14
83 0.11
84 0.11
85 0.07
86 0.07
87 0.07
88 0.05
89 0.05
90 0.04
91 0.04
92 0.04
93 0.04
94 0.03
95 0.03
96 0.03
97 0.04
98 0.05
99 0.05
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.07
108 0.09
109 0.09
110 0.1
111 0.12
112 0.13
113 0.14
114 0.14
115 0.14
116 0.13
117 0.15
118 0.16
119 0.15
120 0.15
121 0.14
122 0.15
123 0.14
124 0.13
125 0.14
126 0.14
127 0.17
128 0.17
129 0.23
130 0.22
131 0.24
132 0.26
133 0.31
134 0.38
135 0.41
136 0.43
137 0.43
138 0.48
139 0.49
140 0.54
141 0.53
142 0.45
143 0.4
144 0.42
145 0.41
146 0.39
147 0.47
148 0.47
149 0.48
150 0.48
151 0.47
152 0.45
153 0.48
154 0.48
155 0.39
156 0.37
157 0.32
158 0.34
159 0.33
160 0.31
161 0.29
162 0.28
163 0.29
164 0.26
165 0.3
166 0.31
167 0.35
168 0.42
169 0.41
170 0.4
171 0.39
172 0.39
173 0.36
174 0.37
175 0.35
176 0.36
177 0.43
178 0.51
179 0.6
180 0.65
181 0.72
182 0.77
183 0.85
184 0.86
185 0.87
186 0.88
187 0.89
188 0.94
189 0.94
190 0.92
191 0.91