Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4I7D0

Protein Details
Accession A0A3N4I7D0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
37-63LEEKKPAHLVRKPFRRRKWQIGFTLFLHydrophilic
NLS Segment(s)
PositionSequence
41-54KPAHLVRKPFRRRK
Subcellular Location(s) plas 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR008521  Mg_trans_NIPA  
Gene Ontology GO:0016020  C:membrane  
GO:0015095  F:magnesium ion transmembrane transporter activity  
Pfam View protein in Pfam  
PF05653  Mg_trans_NIPA  
Amino Acid Sequences MFGSSGSSQITLGVITGLVSTCIQSVGLTLQRKSHMLEEKKPAHLVRKPFRRRKWQIGFTLFLLSNIVGSSVQITVLPLVILSSLQASGLVFNSICATLVLKEPFTNHSLAGTVLVVVGAGVIAWYGAMKDPAHSIDELLQLFGKRNFVIWMILQGVLVLGILLAAKLSVYLRPRLKNTAKMKAFRGVIYGSVSGILSADSLLLAKCMVELLVRTLINHQNQFKRYETWLILIGFLTLALTQLYYLNRGLRLVSTSLLYPLCFCLYNITAICDGIFYYNYSLPALHIALIAVGTAILLGGVLLLSWRLSDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.06
4 0.06
5 0.06
6 0.07
7 0.07
8 0.07
9 0.07
10 0.07
11 0.07
12 0.08
13 0.11
14 0.17
15 0.21
16 0.22
17 0.26
18 0.29
19 0.3
20 0.31
21 0.35
22 0.38
23 0.41
24 0.48
25 0.54
26 0.57
27 0.59
28 0.62
29 0.57
30 0.56
31 0.55
32 0.57
33 0.58
34 0.63
35 0.7
36 0.76
37 0.83
38 0.86
39 0.89
40 0.9
41 0.9
42 0.88
43 0.86
44 0.82
45 0.75
46 0.65
47 0.61
48 0.49
49 0.39
50 0.31
51 0.21
52 0.15
53 0.12
54 0.11
55 0.06
56 0.06
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.06
77 0.06
78 0.05
79 0.06
80 0.07
81 0.07
82 0.07
83 0.06
84 0.07
85 0.07
86 0.11
87 0.12
88 0.11
89 0.12
90 0.13
91 0.16
92 0.17
93 0.17
94 0.13
95 0.12
96 0.12
97 0.12
98 0.11
99 0.08
100 0.06
101 0.05
102 0.05
103 0.04
104 0.03
105 0.03
106 0.02
107 0.02
108 0.01
109 0.01
110 0.01
111 0.01
112 0.02
113 0.02
114 0.03
115 0.04
116 0.05
117 0.05
118 0.07
119 0.08
120 0.09
121 0.09
122 0.09
123 0.1
124 0.13
125 0.12
126 0.11
127 0.11
128 0.1
129 0.12
130 0.12
131 0.11
132 0.08
133 0.09
134 0.09
135 0.09
136 0.1
137 0.09
138 0.09
139 0.09
140 0.09
141 0.09
142 0.08
143 0.07
144 0.05
145 0.05
146 0.03
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.03
156 0.06
157 0.08
158 0.14
159 0.19
160 0.22
161 0.25
162 0.33
163 0.37
164 0.44
165 0.48
166 0.52
167 0.53
168 0.53
169 0.54
170 0.51
171 0.49
172 0.4
173 0.35
174 0.26
175 0.21
176 0.2
177 0.17
178 0.11
179 0.1
180 0.1
181 0.07
182 0.07
183 0.06
184 0.04
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.04
197 0.04
198 0.06
199 0.1
200 0.1
201 0.11
202 0.16
203 0.21
204 0.25
205 0.3
206 0.33
207 0.36
208 0.39
209 0.43
210 0.41
211 0.39
212 0.37
213 0.38
214 0.33
215 0.28
216 0.3
217 0.27
218 0.25
219 0.21
220 0.18
221 0.12
222 0.11
223 0.09
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.07
230 0.08
231 0.09
232 0.11
233 0.13
234 0.14
235 0.15
236 0.15
237 0.13
238 0.15
239 0.15
240 0.14
241 0.13
242 0.13
243 0.15
244 0.15
245 0.14
246 0.12
247 0.13
248 0.13
249 0.13
250 0.13
251 0.16
252 0.16
253 0.21
254 0.2
255 0.21
256 0.2
257 0.2
258 0.19
259 0.14
260 0.13
261 0.1
262 0.1
263 0.09
264 0.12
265 0.14
266 0.15
267 0.15
268 0.15
269 0.14
270 0.17
271 0.16
272 0.13
273 0.11
274 0.1
275 0.1
276 0.09
277 0.08
278 0.05
279 0.04
280 0.03
281 0.03
282 0.03
283 0.02
284 0.02
285 0.02
286 0.02
287 0.02
288 0.02
289 0.02
290 0.03
291 0.04