Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IGJ2

Protein Details
Accession A0A3N4IGJ2    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
229-256AISVVIWCRRRKRREKEPKKSQPAELHGHydrophilic
NLS Segment(s)
PositionSequence
237-248RRRKRREKEPKK
Subcellular Location(s) cyto 11.5, cyto_nucl 7.5, mito 5, plas 4, nucl 2.5, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFVCNTAQPVALHRSGPVVQTFPEDSSPLTVVQVNPTIYITAGNDKSILATRPQAHGPFPHLLLSTACAWSSEMGLARWHTDLWKSLLKFSDATAIFPVAALVSTLRPNFFAVATKIWIGAPLLFAGNTHYPGVCRGLGTKAVFPEGYASYVTPFVNTRTDTFTAPPRRARQGGFTEVNAEATGVTEQLTISEYYPGPRSLSDLLENPPTRTLAVGLVASLGASIIIIAISVVIWCRRRKRREKEPKKSQPAELHGEGLLHQLDSESILKPESVMEPQELPGPEPQEMSADGVFEAPAYRAEERVYNDDKEQQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.28
4 0.26
5 0.21
6 0.2
7 0.24
8 0.25
9 0.23
10 0.23
11 0.21
12 0.19
13 0.2
14 0.21
15 0.17
16 0.16
17 0.17
18 0.16
19 0.19
20 0.22
21 0.19
22 0.19
23 0.19
24 0.18
25 0.15
26 0.16
27 0.14
28 0.17
29 0.18
30 0.17
31 0.17
32 0.17
33 0.18
34 0.2
35 0.19
36 0.15
37 0.2
38 0.23
39 0.26
40 0.3
41 0.3
42 0.3
43 0.31
44 0.33
45 0.3
46 0.28
47 0.27
48 0.24
49 0.23
50 0.21
51 0.21
52 0.18
53 0.15
54 0.14
55 0.12
56 0.12
57 0.11
58 0.11
59 0.11
60 0.1
61 0.1
62 0.12
63 0.12
64 0.13
65 0.13
66 0.13
67 0.13
68 0.13
69 0.15
70 0.18
71 0.23
72 0.22
73 0.25
74 0.27
75 0.27
76 0.26
77 0.23
78 0.27
79 0.21
80 0.22
81 0.19
82 0.18
83 0.16
84 0.15
85 0.14
86 0.06
87 0.06
88 0.05
89 0.04
90 0.05
91 0.08
92 0.09
93 0.09
94 0.1
95 0.11
96 0.11
97 0.11
98 0.13
99 0.12
100 0.13
101 0.14
102 0.13
103 0.13
104 0.12
105 0.12
106 0.1
107 0.08
108 0.07
109 0.06
110 0.06
111 0.06
112 0.06
113 0.08
114 0.09
115 0.09
116 0.09
117 0.09
118 0.09
119 0.1
120 0.13
121 0.1
122 0.09
123 0.09
124 0.11
125 0.15
126 0.15
127 0.16
128 0.14
129 0.15
130 0.14
131 0.13
132 0.14
133 0.1
134 0.1
135 0.09
136 0.09
137 0.08
138 0.1
139 0.1
140 0.08
141 0.08
142 0.09
143 0.11
144 0.12
145 0.12
146 0.15
147 0.17
148 0.17
149 0.18
150 0.25
151 0.28
152 0.3
153 0.35
154 0.34
155 0.38
156 0.39
157 0.39
158 0.37
159 0.37
160 0.4
161 0.36
162 0.32
163 0.3
164 0.27
165 0.27
166 0.2
167 0.15
168 0.08
169 0.07
170 0.07
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.06
177 0.06
178 0.06
179 0.09
180 0.08
181 0.1
182 0.12
183 0.13
184 0.12
185 0.12
186 0.14
187 0.14
188 0.16
189 0.16
190 0.16
191 0.18
192 0.25
193 0.25
194 0.23
195 0.22
196 0.21
197 0.19
198 0.17
199 0.16
200 0.09
201 0.1
202 0.09
203 0.07
204 0.07
205 0.07
206 0.06
207 0.05
208 0.04
209 0.02
210 0.02
211 0.02
212 0.02
213 0.02
214 0.02
215 0.02
216 0.02
217 0.02
218 0.02
219 0.04
220 0.08
221 0.13
222 0.18
223 0.29
224 0.39
225 0.49
226 0.6
227 0.7
228 0.78
229 0.85
230 0.91
231 0.93
232 0.95
233 0.95
234 0.95
235 0.9
236 0.86
237 0.83
238 0.78
239 0.74
240 0.64
241 0.54
242 0.44
243 0.39
244 0.31
245 0.25
246 0.19
247 0.11
248 0.09
249 0.07
250 0.07
251 0.09
252 0.11
253 0.09
254 0.1
255 0.11
256 0.11
257 0.11
258 0.12
259 0.13
260 0.14
261 0.14
262 0.16
263 0.17
264 0.18
265 0.23
266 0.22
267 0.21
268 0.22
269 0.23
270 0.22
271 0.21
272 0.21
273 0.18
274 0.18
275 0.2
276 0.16
277 0.13
278 0.13
279 0.12
280 0.11
281 0.09
282 0.09
283 0.07
284 0.09
285 0.13
286 0.13
287 0.14
288 0.16
289 0.21
290 0.25
291 0.32
292 0.34
293 0.33
294 0.36