Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8MZP0

Protein Details
Accession B8MZP0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
156-176ELMKELKIKKQREKEEKAAEVHydrophilic
NLS Segment(s)
PositionSequence
163-173IKKQREKEEKA
184-185KK
Subcellular Location(s) nucl 11.5, cyto_nucl 9, pero 6, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022533  Cox20  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF12597  Cox20  
Amino Acid Sequences MAGDTLESSTPNVEQHNSSQETSHQNKPKHEFPKSQVGKLWDAFGNPEESANVLATGAGPSGRGSKDATVTEAMKSMSLKDVTSFYKAPCARDSLLLGIGAGFGIGGIRGVLGGLRSLWTASNWAVGAFALTSLAAHEFCQRRRVQELDGMKQAVELMKELKIKKQREKEEKAAEVARLAEEEKKKKSWTNLSNYKFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.29
4 0.31
5 0.3
6 0.3
7 0.32
8 0.39
9 0.41
10 0.47
11 0.47
12 0.49
13 0.57
14 0.62
15 0.66
16 0.67
17 0.69
18 0.67
19 0.64
20 0.7
21 0.66
22 0.63
23 0.58
24 0.53
25 0.5
26 0.43
27 0.41
28 0.31
29 0.27
30 0.25
31 0.22
32 0.2
33 0.16
34 0.15
35 0.12
36 0.11
37 0.12
38 0.1
39 0.09
40 0.06
41 0.06
42 0.06
43 0.06
44 0.05
45 0.04
46 0.04
47 0.05
48 0.08
49 0.08
50 0.09
51 0.11
52 0.12
53 0.15
54 0.15
55 0.17
56 0.16
57 0.17
58 0.16
59 0.16
60 0.15
61 0.12
62 0.12
63 0.11
64 0.11
65 0.11
66 0.11
67 0.1
68 0.13
69 0.14
70 0.17
71 0.17
72 0.14
73 0.22
74 0.23
75 0.24
76 0.23
77 0.25
78 0.22
79 0.23
80 0.23
81 0.16
82 0.15
83 0.13
84 0.12
85 0.08
86 0.07
87 0.05
88 0.04
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.03
101 0.03
102 0.04
103 0.04
104 0.04
105 0.05
106 0.05
107 0.07
108 0.07
109 0.08
110 0.08
111 0.08
112 0.08
113 0.07
114 0.07
115 0.05
116 0.05
117 0.03
118 0.03
119 0.03
120 0.03
121 0.04
122 0.05
123 0.05
124 0.12
125 0.16
126 0.18
127 0.26
128 0.27
129 0.3
130 0.34
131 0.36
132 0.32
133 0.36
134 0.41
135 0.39
136 0.42
137 0.38
138 0.33
139 0.31
140 0.29
141 0.23
142 0.16
143 0.12
144 0.1
145 0.14
146 0.19
147 0.2
148 0.27
149 0.35
150 0.43
151 0.51
152 0.6
153 0.67
154 0.72
155 0.8
156 0.82
157 0.83
158 0.78
159 0.74
160 0.66
161 0.56
162 0.47
163 0.39
164 0.3
165 0.21
166 0.19
167 0.21
168 0.27
169 0.33
170 0.37
171 0.41
172 0.45
173 0.5
174 0.58
175 0.62
176 0.63
177 0.67
178 0.72