Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4I6J3

Protein Details
Accession A0A3N4I6J3   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
152-191TSSAPQHQEKPKPPRRLPTAKRWRILQTRKCWRKHTGKKNHydrophilic
NLS Segment(s)
PositionSequence
161-191KPKPPRRLPTAKRWRILQTRKCWRKHTGKKN
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MRLNIHYPAPPAPEPAPACALSATGHQPQPQPRPTQRKLSTAGAIKVEINSGSISGNRNPNIPAPATTTGPNTEKGPTKQPGNREPSPSALVMDSEIDLGPVQTTEPGNHELDPSASVTNSQADLLEEPFITAENVTVHKILCPRCRDCSATSSAPQHQEKPKPPRRLPTAKRWRILQTRKCWRKHTGKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.34
4 0.28
5 0.28
6 0.23
7 0.23
8 0.16
9 0.17
10 0.19
11 0.2
12 0.22
13 0.24
14 0.3
15 0.37
16 0.45
17 0.48
18 0.52
19 0.57
20 0.65
21 0.67
22 0.73
23 0.7
24 0.68
25 0.67
26 0.63
27 0.59
28 0.54
29 0.52
30 0.43
31 0.39
32 0.32
33 0.27
34 0.23
35 0.17
36 0.12
37 0.09
38 0.08
39 0.08
40 0.09
41 0.11
42 0.14
43 0.2
44 0.2
45 0.21
46 0.22
47 0.24
48 0.25
49 0.23
50 0.2
51 0.2
52 0.21
53 0.21
54 0.21
55 0.2
56 0.21
57 0.21
58 0.21
59 0.17
60 0.18
61 0.22
62 0.23
63 0.28
64 0.29
65 0.34
66 0.35
67 0.41
68 0.46
69 0.49
70 0.5
71 0.48
72 0.46
73 0.42
74 0.41
75 0.35
76 0.27
77 0.19
78 0.16
79 0.11
80 0.1
81 0.07
82 0.06
83 0.05
84 0.05
85 0.04
86 0.04
87 0.04
88 0.03
89 0.03
90 0.04
91 0.05
92 0.05
93 0.08
94 0.11
95 0.12
96 0.12
97 0.12
98 0.11
99 0.11
100 0.12
101 0.11
102 0.08
103 0.07
104 0.07
105 0.08
106 0.08
107 0.08
108 0.08
109 0.07
110 0.07
111 0.08
112 0.08
113 0.08
114 0.07
115 0.07
116 0.07
117 0.07
118 0.06
119 0.05
120 0.06
121 0.06
122 0.08
123 0.09
124 0.09
125 0.09
126 0.11
127 0.17
128 0.22
129 0.28
130 0.34
131 0.37
132 0.42
133 0.46
134 0.48
135 0.46
136 0.45
137 0.44
138 0.42
139 0.42
140 0.42
141 0.42
142 0.46
143 0.46
144 0.48
145 0.5
146 0.55
147 0.6
148 0.66
149 0.71
150 0.74
151 0.77
152 0.8
153 0.82
154 0.84
155 0.81
156 0.82
157 0.84
158 0.82
159 0.81
160 0.76
161 0.76
162 0.76
163 0.79
164 0.77
165 0.77
166 0.8
167 0.84
168 0.86
169 0.83
170 0.82
171 0.83