Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4IRM2

Protein Details
Accession A0A3N4IRM2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
46-74ISQVSSARSTRRRRNRNRNRKSRNAGGVAHydrophilic
NLS Segment(s)
PositionSequence
55-68TRRRRNRNRNRKSR
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MSSAAGSGSHHSGPAPQQDAPQNTGPQNRGADLALSDNEVDPSDSISQVSSARSTRRRRNRNRNRKSRNAGGVADGLLDPVNEVGGQLSKTAGGLTNQVGNTLGGVTGALGGVTGQGQQGGESGGDKKDTLRLRLDLNLDAELTLKAKVHGDVTLALLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.24
4 0.29
5 0.36
6 0.39
7 0.4
8 0.41
9 0.38
10 0.38
11 0.43
12 0.4
13 0.38
14 0.36
15 0.32
16 0.29
17 0.25
18 0.21
19 0.17
20 0.17
21 0.13
22 0.12
23 0.11
24 0.1
25 0.1
26 0.1
27 0.09
28 0.07
29 0.09
30 0.09
31 0.09
32 0.09
33 0.09
34 0.09
35 0.1
36 0.11
37 0.11
38 0.12
39 0.18
40 0.27
41 0.35
42 0.44
43 0.54
44 0.64
45 0.73
46 0.83
47 0.88
48 0.91
49 0.94
50 0.95
51 0.93
52 0.93
53 0.89
54 0.85
55 0.8
56 0.73
57 0.62
58 0.53
59 0.44
60 0.33
61 0.26
62 0.18
63 0.11
64 0.07
65 0.06
66 0.04
67 0.03
68 0.03
69 0.02
70 0.03
71 0.03
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.05
81 0.07
82 0.07
83 0.11
84 0.1
85 0.11
86 0.11
87 0.1
88 0.1
89 0.08
90 0.07
91 0.04
92 0.04
93 0.03
94 0.03
95 0.03
96 0.03
97 0.02
98 0.02
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.04
105 0.04
106 0.05
107 0.05
108 0.05
109 0.06
110 0.08
111 0.09
112 0.1
113 0.1
114 0.1
115 0.17
116 0.21
117 0.24
118 0.27
119 0.28
120 0.3
121 0.35
122 0.37
123 0.33
124 0.31
125 0.28
126 0.23
127 0.21
128 0.19
129 0.15
130 0.13
131 0.11
132 0.1
133 0.1
134 0.11
135 0.13
136 0.14
137 0.14
138 0.15
139 0.15