Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HY41

Protein Details
Accession A0A3N4HY41    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
152-193GSRRNGSRARRTGCRRNGSRSRRNGSRERKTGYQRNGSRERRBasic
NLS Segment(s)
PositionSequence
152-194GSRRNGSRARRTGCRRNGSRSRRNGSRERKTGYQRNGSRERRI
Subcellular Location(s) cyto 8.5, cyto_nucl 7.5, nucl 5.5, mito 5, plas 3, pero 3
Family & Domain DBs
Amino Acid Sequences MLDLQHGIDRDRSSRPSQTDCRLHVVTCSALNGPCRITTCNRVQDLRAVGVRHCGRELRANITTPATDLDCCQLLLTSKISGKACTFGASSRVEEKIVEGLALGLGGLVALGGLEALGELALGGPALGGPAFGGLALGGLALSEGWLGGKTGSRRNGSRARRTGCRRNGSRSRRNGSRERKTGYQRNGSRERRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.49
4 0.54
5 0.6
6 0.62
7 0.61
8 0.62
9 0.56
10 0.51
11 0.44
12 0.39
13 0.32
14 0.25
15 0.23
16 0.18
17 0.18
18 0.2
19 0.2
20 0.18
21 0.18
22 0.19
23 0.21
24 0.24
25 0.29
26 0.35
27 0.41
28 0.44
29 0.44
30 0.43
31 0.45
32 0.43
33 0.4
34 0.35
35 0.28
36 0.24
37 0.31
38 0.32
39 0.28
40 0.26
41 0.24
42 0.23
43 0.3
44 0.32
45 0.29
46 0.3
47 0.3
48 0.3
49 0.3
50 0.28
51 0.2
52 0.19
53 0.14
54 0.11
55 0.1
56 0.1
57 0.1
58 0.09
59 0.09
60 0.08
61 0.08
62 0.09
63 0.1
64 0.1
65 0.11
66 0.15
67 0.16
68 0.16
69 0.16
70 0.16
71 0.15
72 0.15
73 0.14
74 0.11
75 0.14
76 0.14
77 0.14
78 0.15
79 0.15
80 0.14
81 0.13
82 0.13
83 0.11
84 0.09
85 0.08
86 0.06
87 0.05
88 0.04
89 0.04
90 0.03
91 0.02
92 0.02
93 0.02
94 0.01
95 0.01
96 0.01
97 0.01
98 0.01
99 0.01
100 0.01
101 0.01
102 0.01
103 0.01
104 0.01
105 0.01
106 0.01
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.03
134 0.03
135 0.04
136 0.08
137 0.11
138 0.18
139 0.25
140 0.3
141 0.32
142 0.39
143 0.48
144 0.54
145 0.61
146 0.64
147 0.64
148 0.69
149 0.76
150 0.79
151 0.79
152 0.81
153 0.77
154 0.78
155 0.82
156 0.83
157 0.84
158 0.84
159 0.83
160 0.81
161 0.83
162 0.83
163 0.83
164 0.83
165 0.82
166 0.78
167 0.78
168 0.8
169 0.82
170 0.81
171 0.8
172 0.76
173 0.77
174 0.81