Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IFK8

Protein Details
Accession A0A3N4IFK8    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-39TPLALAKPTKQPKPNCPPRKVSQKEQHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, golg 5, mito 3, nucl 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR032710  NTF2-like_dom_sf  
Amino Acid Sequences MRFLGLISLLLAATPLALAKPTKQPKPNCPPRKVSQKEQREIFDKFVKTFWLDKTPPIAFANHVDENYIQHNPNALSGRQVAIDTFAKMNMDSITYTILNKGFDDNVGWVHYKMEMPGLPQPYAVVDTVRFEGSCIMEHWDVSQMRPANSINPIAMW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.06
5 0.07
6 0.1
7 0.21
8 0.29
9 0.37
10 0.46
11 0.53
12 0.62
13 0.73
14 0.81
15 0.81
16 0.8
17 0.8
18 0.8
19 0.84
20 0.8
21 0.79
22 0.79
23 0.79
24 0.79
25 0.76
26 0.72
27 0.66
28 0.62
29 0.56
30 0.53
31 0.44
32 0.37
33 0.33
34 0.3
35 0.27
36 0.28
37 0.26
38 0.27
39 0.26
40 0.26
41 0.32
42 0.3
43 0.3
44 0.28
45 0.25
46 0.18
47 0.21
48 0.25
49 0.2
50 0.19
51 0.17
52 0.17
53 0.17
54 0.18
55 0.17
56 0.12
57 0.11
58 0.13
59 0.12
60 0.15
61 0.15
62 0.13
63 0.13
64 0.13
65 0.13
66 0.12
67 0.11
68 0.08
69 0.09
70 0.1
71 0.09
72 0.09
73 0.08
74 0.08
75 0.08
76 0.09
77 0.07
78 0.07
79 0.06
80 0.06
81 0.08
82 0.08
83 0.08
84 0.09
85 0.1
86 0.1
87 0.1
88 0.11
89 0.09
90 0.09
91 0.1
92 0.09
93 0.09
94 0.1
95 0.11
96 0.1
97 0.1
98 0.11
99 0.1
100 0.1
101 0.12
102 0.11
103 0.12
104 0.17
105 0.2
106 0.19
107 0.19
108 0.18
109 0.17
110 0.18
111 0.15
112 0.11
113 0.09
114 0.11
115 0.13
116 0.14
117 0.13
118 0.11
119 0.13
120 0.13
121 0.14
122 0.13
123 0.16
124 0.16
125 0.16
126 0.17
127 0.21
128 0.21
129 0.2
130 0.27
131 0.25
132 0.26
133 0.29
134 0.29
135 0.26
136 0.29
137 0.31