Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4I8I8

Protein Details
Accession A0A3N4I8I8   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-33ASDLPTRKPLQKRAKASQLGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.333, nucl 11.5, cyto 11, mito_nucl 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR034904  FSCA_dom_sf  
IPR039796  MIP18  
IPR002744  MIP18-like  
Gene Ontology GO:0106035  P:protein maturation by [4Fe-4S] cluster transfer  
Pfam View protein in Pfam  
PF01883  FeS_assembly_P  
Amino Acid Sequences MAEMDNANPTVLAASDLPTRKPLQKRAKASQLGIFASIPRVSPVRDPFTVTPGQLYESDTSDSEEDFELDAEGDNGVEEIDSQEIYDLIAPISDPEHPLSLGELAVVNLPHIYITPGNPISTVLVEITPTITHCSLATVIGLGVRVRLEQALPPRYRVDVRIREGTHSTGDQVNKQLADKERVAAACENESLMSLLRKMLEGCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.16
3 0.18
4 0.19
5 0.23
6 0.26
7 0.33
8 0.4
9 0.49
10 0.53
11 0.62
12 0.7
13 0.75
14 0.81
15 0.79
16 0.74
17 0.69
18 0.62
19 0.54
20 0.46
21 0.37
22 0.27
23 0.24
24 0.22
25 0.16
26 0.13
27 0.14
28 0.13
29 0.19
30 0.25
31 0.28
32 0.28
33 0.33
34 0.32
35 0.36
36 0.37
37 0.3
38 0.26
39 0.2
40 0.21
41 0.17
42 0.18
43 0.15
44 0.14
45 0.15
46 0.14
47 0.15
48 0.14
49 0.13
50 0.12
51 0.1
52 0.09
53 0.08
54 0.08
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.04
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.05
81 0.05
82 0.06
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.06
89 0.05
90 0.05
91 0.04
92 0.05
93 0.05
94 0.04
95 0.04
96 0.04
97 0.03
98 0.04
99 0.05
100 0.05
101 0.06
102 0.1
103 0.11
104 0.11
105 0.11
106 0.11
107 0.11
108 0.1
109 0.1
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.05
116 0.06
117 0.08
118 0.08
119 0.08
120 0.08
121 0.09
122 0.09
123 0.09
124 0.08
125 0.06
126 0.06
127 0.06
128 0.06
129 0.05
130 0.05
131 0.05
132 0.06
133 0.06
134 0.06
135 0.07
136 0.1
137 0.18
138 0.26
139 0.26
140 0.29
141 0.3
142 0.32
143 0.34
144 0.35
145 0.38
146 0.38
147 0.42
148 0.49
149 0.48
150 0.49
151 0.5
152 0.47
153 0.4
154 0.31
155 0.28
156 0.25
157 0.26
158 0.25
159 0.26
160 0.27
161 0.25
162 0.25
163 0.29
164 0.29
165 0.33
166 0.31
167 0.3
168 0.31
169 0.3
170 0.33
171 0.3
172 0.27
173 0.23
174 0.22
175 0.21
176 0.17
177 0.17
178 0.15
179 0.13
180 0.13
181 0.11
182 0.13
183 0.13
184 0.14