Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HLE2

Protein Details
Accession A0A3N4HLE2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
22-42LSTPTRCKMFRKRLDRTRPVIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, mito 9, E.R. 3, cyto 1, extr 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MMILHANLAAPESAPMNHCTALSTPTRCKMFRKRLDRTRPVISFHPKPAIGLHSILLCHMASILLALSCVVLMSSHFLEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.14
4 0.14
5 0.14
6 0.15
7 0.15
8 0.17
9 0.2
10 0.23
11 0.23
12 0.29
13 0.33
14 0.33
15 0.39
16 0.46
17 0.52
18 0.58
19 0.64
20 0.68
21 0.74
22 0.84
23 0.84
24 0.79
25 0.76
26 0.68
27 0.61
28 0.58
29 0.54
30 0.47
31 0.42
32 0.41
33 0.33
34 0.32
35 0.3
36 0.26
37 0.21
38 0.18
39 0.16
40 0.12
41 0.12
42 0.12
43 0.12
44 0.09
45 0.07
46 0.06
47 0.06
48 0.04
49 0.05
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.03
58 0.03
59 0.04
60 0.08