Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HZZ1

Protein Details
Accession A0A3N4HZZ1    Localization Confidence High Confidence Score 19.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MPDSYYRDKERKREEKKREKMERKEVQQKDKEBasic
50-69FRPKQAKPYKPKRSASQEKVHydrophilic
NLS Segment(s)
PositionSequence
9-37KERKREEKKREKMERKEVQQKDKEAREKE
51-72RPKQAKPYKPKRSASQEKVEKE
Subcellular Location(s) nucl 21, mito 6
Family & Domain DBs
Amino Acid Sequences MPDSYYRDKERKREEKKREKMERKEVQQKDKEAREKEFGEKEPRCLEMLFRPKQAKPYKPKRSASQEKVEKESRRRTVQAIPPSMNGIMGRVPRCSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.92
4 0.93
5 0.94
6 0.93
7 0.92
8 0.92
9 0.9
10 0.88
11 0.89
12 0.85
13 0.83
14 0.79
15 0.76
16 0.73
17 0.71
18 0.7
19 0.63
20 0.6
21 0.55
22 0.51
23 0.5
24 0.47
25 0.43
26 0.44
27 0.41
28 0.41
29 0.37
30 0.36
31 0.31
32 0.26
33 0.24
34 0.22
35 0.31
36 0.29
37 0.32
38 0.34
39 0.34
40 0.43
41 0.49
42 0.49
43 0.51
44 0.6
45 0.66
46 0.72
47 0.77
48 0.76
49 0.79
50 0.81
51 0.78
52 0.78
53 0.75
54 0.7
55 0.71
56 0.7
57 0.66
58 0.64
59 0.67
60 0.64
61 0.62
62 0.61
63 0.59
64 0.61
65 0.62
66 0.63
67 0.6
68 0.55
69 0.49
70 0.49
71 0.45
72 0.37
73 0.28
74 0.2
75 0.18
76 0.22
77 0.22