Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IBB4

Protein Details
Accession A0A3N4IBB4    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-113APRNTYKDPTWRVRKRRHGFLAKIGSRTGRIVIKRRKAKGRKNLSCHydrophilic
NLS Segment(s)
PositionSequence
79-109RVRKRRHGFLAKIGSRTGRIVIKRRKAKGRK
Subcellular Location(s) mito 19.5, cyto_mito 11.5, nucl 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLFQRALFQSRVRLATFSRGLVTMANSFRPAVPVPSSGTSQLYKIDRVQPQLTSPILPTLDLNQVRFAPRNTYKDPTWRVRKRRHGFLAKIGSRTGRIVIKRRKAKGRKNLSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.35
4 0.29
5 0.25
6 0.23
7 0.22
8 0.21
9 0.21
10 0.18
11 0.17
12 0.17
13 0.17
14 0.17
15 0.16
16 0.18
17 0.17
18 0.15
19 0.15
20 0.16
21 0.18
22 0.19
23 0.2
24 0.19
25 0.21
26 0.18
27 0.17
28 0.2
29 0.18
30 0.18
31 0.19
32 0.25
33 0.25
34 0.29
35 0.3
36 0.26
37 0.26
38 0.27
39 0.25
40 0.19
41 0.16
42 0.14
43 0.12
44 0.11
45 0.1
46 0.1
47 0.16
48 0.16
49 0.16
50 0.16
51 0.17
52 0.18
53 0.2
54 0.19
55 0.2
56 0.25
57 0.31
58 0.34
59 0.37
60 0.38
61 0.45
62 0.51
63 0.52
64 0.58
65 0.61
66 0.67
67 0.72
68 0.82
69 0.81
70 0.84
71 0.85
72 0.84
73 0.79
74 0.79
75 0.79
76 0.71
77 0.65
78 0.57
79 0.48
80 0.4
81 0.37
82 0.31
83 0.27
84 0.3
85 0.38
86 0.47
87 0.56
88 0.63
89 0.71
90 0.78
91 0.82
92 0.86
93 0.87