Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4INS2

Protein Details
Accession A0A3N4INS2    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
17-45KGRFTHPQNFEKARRKRKLRIYSPNIETTHydrophilic
134-184KKIKVKDYKHHVSTRKKEKESPVRGNGEVKRPRKGKKRSARCKAGEWRTNSBasic
NLS Segment(s)
PositionSequence
28-34KARRKRK
135-176KIKVKDYKHHVSTRKKEKESPVRGNGEVKRPRKGKKRSARCK
Subcellular Location(s) nucl 13.5, mito_nucl 11.166, cyto_nucl 10.333, mito 7.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MTTALTAVIEVGAIGLKGRFTHPQNFEKARRKRKLRIYSPNIETTGYEIAKDKMRSENQARKATSLVQYNQCEQAGVIGTSRAAQIRIQDLTAIQTQSLEPEHDMGNTSKQLGEALIDRNKRNISRQLEGEYEKKIKVKDYKHHVSTRKKEKESPVRGNGEVKRPRKGKKRSARCKAGEWRTNSARDLKKAQALD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.07
5 0.1
6 0.16
7 0.21
8 0.3
9 0.37
10 0.43
11 0.51
12 0.58
13 0.65
14 0.69
15 0.75
16 0.77
17 0.8
18 0.83
19 0.84
20 0.86
21 0.88
22 0.88
23 0.89
24 0.87
25 0.86
26 0.82
27 0.77
28 0.68
29 0.57
30 0.46
31 0.38
32 0.34
33 0.25
34 0.2
35 0.17
36 0.18
37 0.23
38 0.24
39 0.23
40 0.25
41 0.28
42 0.35
43 0.42
44 0.5
45 0.53
46 0.6
47 0.58
48 0.52
49 0.5
50 0.47
51 0.42
52 0.39
53 0.35
54 0.34
55 0.35
56 0.36
57 0.37
58 0.33
59 0.28
60 0.22
61 0.19
62 0.13
63 0.11
64 0.09
65 0.07
66 0.07
67 0.07
68 0.08
69 0.07
70 0.06
71 0.07
72 0.08
73 0.11
74 0.11
75 0.11
76 0.1
77 0.1
78 0.11
79 0.12
80 0.11
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.07
87 0.06
88 0.07
89 0.07
90 0.07
91 0.09
92 0.08
93 0.1
94 0.1
95 0.1
96 0.09
97 0.09
98 0.09
99 0.07
100 0.08
101 0.08
102 0.12
103 0.17
104 0.2
105 0.2
106 0.24
107 0.27
108 0.28
109 0.31
110 0.35
111 0.36
112 0.36
113 0.39
114 0.39
115 0.39
116 0.41
117 0.38
118 0.33
119 0.3
120 0.28
121 0.28
122 0.26
123 0.29
124 0.34
125 0.4
126 0.44
127 0.52
128 0.59
129 0.64
130 0.71
131 0.73
132 0.76
133 0.78
134 0.8
135 0.81
136 0.76
137 0.76
138 0.78
139 0.8
140 0.8
141 0.79
142 0.76
143 0.71
144 0.69
145 0.69
146 0.64
147 0.63
148 0.62
149 0.56
150 0.57
151 0.59
152 0.67
153 0.7
154 0.76
155 0.76
156 0.78
157 0.86
158 0.87
159 0.91
160 0.92
161 0.87
162 0.86
163 0.86
164 0.85
165 0.82
166 0.76
167 0.75
168 0.7
169 0.69
170 0.62
171 0.61
172 0.57
173 0.56
174 0.56
175 0.52