Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HLK4

Protein Details
Accession A0A3N4HLK4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
39-58KPSPKFPKPSPEKPKPSPKFBasic
NLS Segment(s)
PositionSequence
25-68KPSPEFPKPSPEIPKPSPKFPKPSPEKPKPSPKFPKPSPKFPKP
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
Amino Acid Sequences MMDMWFHGFPKPSPEFPKPSPEFPKPSPEFPKPSPEIPKPSPKFPKPSPEKPKPSPKFPKPSPKFPKPSPEILLHPRSYPEIYFGDGPRFRGRWAEILVVGLFFGDDPRTYTYHLLHREVFNQALTSVRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.51
4 0.61
5 0.57
6 0.6
7 0.62
8 0.61
9 0.62
10 0.58
11 0.65
12 0.59
13 0.63
14 0.63
15 0.61
16 0.62
17 0.58
18 0.64
19 0.56
20 0.58
21 0.58
22 0.56
23 0.57
24 0.54
25 0.62
26 0.56
27 0.62
28 0.65
29 0.62
30 0.65
31 0.61
32 0.66
33 0.64
34 0.72
35 0.72
36 0.73
37 0.77
38 0.77
39 0.83
40 0.78
41 0.79
42 0.79
43 0.77
44 0.77
45 0.76
46 0.79
47 0.73
48 0.79
49 0.78
50 0.77
51 0.75
52 0.69
53 0.72
54 0.64
55 0.64
56 0.56
57 0.5
58 0.46
59 0.46
60 0.46
61 0.37
62 0.34
63 0.29
64 0.28
65 0.25
66 0.21
67 0.18
68 0.14
69 0.15
70 0.17
71 0.17
72 0.22
73 0.22
74 0.25
75 0.26
76 0.25
77 0.24
78 0.26
79 0.27
80 0.25
81 0.26
82 0.25
83 0.21
84 0.22
85 0.22
86 0.18
87 0.15
88 0.1
89 0.07
90 0.05
91 0.05
92 0.05
93 0.05
94 0.08
95 0.11
96 0.12
97 0.15
98 0.18
99 0.21
100 0.28
101 0.33
102 0.35
103 0.36
104 0.37
105 0.38
106 0.39
107 0.37
108 0.3
109 0.25
110 0.22