Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HX25

Protein Details
Accession A0A3N4HX25    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
89-120GWSSWKRRTGQEEIRRKRKARKAKALALARSGHydrophilic
NLS Segment(s)
PositionSequence
96-113RTGQEEIRRKRKARKAKA
Subcellular Location(s) cyto 11.5, plas 10, cyto_nucl 8, nucl 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSPLPHNGEHQGVVQVTEETPTSPYNPPLRPHILPISTPKATGYNFPIPKPFDEELDGGDETKPKLAAGVIAAIVVLSVLAVVVVGFCGWSSWKRRTGQEEIRRKRKARKAKALALARSGSNETT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.13
4 0.13
5 0.12
6 0.09
7 0.11
8 0.11
9 0.14
10 0.15
11 0.21
12 0.27
13 0.31
14 0.33
15 0.38
16 0.44
17 0.41
18 0.44
19 0.44
20 0.38
21 0.36
22 0.4
23 0.4
24 0.34
25 0.33
26 0.29
27 0.26
28 0.25
29 0.25
30 0.25
31 0.28
32 0.29
33 0.3
34 0.33
35 0.32
36 0.32
37 0.36
38 0.3
39 0.22
40 0.23
41 0.22
42 0.19
43 0.2
44 0.19
45 0.12
46 0.12
47 0.12
48 0.09
49 0.1
50 0.09
51 0.06
52 0.06
53 0.05
54 0.06
55 0.05
56 0.06
57 0.05
58 0.05
59 0.05
60 0.04
61 0.04
62 0.03
63 0.03
64 0.01
65 0.01
66 0.01
67 0.01
68 0.01
69 0.01
70 0.01
71 0.02
72 0.02
73 0.02
74 0.02
75 0.03
76 0.04
77 0.09
78 0.14
79 0.2
80 0.27
81 0.31
82 0.37
83 0.44
84 0.52
85 0.59
86 0.64
87 0.7
88 0.74
89 0.8
90 0.83
91 0.81
92 0.82
93 0.82
94 0.83
95 0.83
96 0.84
97 0.84
98 0.85
99 0.89
100 0.87
101 0.8
102 0.74
103 0.65
104 0.55
105 0.48