Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HF37

Protein Details
Accession A0A3N4HF37    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-68KNRGVSRRKRAANRAKNHRRFALBasic
NLS Segment(s)
PositionSequence
42-65RKIAKNRGVSRRKRAANRAKNHRR
Subcellular Location(s) cyto_nucl 7.833, nucl 7.5, mito 7, cyto 7, cyto_pero 5.833, pero 3.5
Family & Domain DBs
Amino Acid Sequences MAAGGAFMQNIGPLPAAPQLPVTNREHYAEIRPTDNHAQIVRKIAKNRGVSRRKRAANRAKNHRRFALLKNPLTGTRPAGCPNTYNTVIAFTRAQWYNIAIPMGYPEWLGGNGQPAATLGRMRNEWCCDHGVDILRPADIRAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.12
4 0.12
5 0.14
6 0.16
7 0.19
8 0.24
9 0.27
10 0.28
11 0.29
12 0.31
13 0.31
14 0.3
15 0.34
16 0.34
17 0.32
18 0.31
19 0.3
20 0.33
21 0.35
22 0.35
23 0.32
24 0.28
25 0.3
26 0.28
27 0.36
28 0.37
29 0.36
30 0.38
31 0.41
32 0.46
33 0.51
34 0.57
35 0.59
36 0.63
37 0.66
38 0.72
39 0.75
40 0.75
41 0.74
42 0.77
43 0.77
44 0.77
45 0.79
46 0.81
47 0.83
48 0.84
49 0.81
50 0.73
51 0.67
52 0.61
53 0.56
54 0.56
55 0.53
56 0.45
57 0.43
58 0.42
59 0.37
60 0.35
61 0.31
62 0.23
63 0.17
64 0.17
65 0.18
66 0.19
67 0.19
68 0.18
69 0.2
70 0.23
71 0.21
72 0.2
73 0.18
74 0.19
75 0.19
76 0.19
77 0.17
78 0.12
79 0.16
80 0.17
81 0.17
82 0.14
83 0.16
84 0.16
85 0.17
86 0.17
87 0.11
88 0.1
89 0.12
90 0.12
91 0.1
92 0.08
93 0.07
94 0.07
95 0.08
96 0.08
97 0.07
98 0.1
99 0.1
100 0.1
101 0.1
102 0.09
103 0.1
104 0.11
105 0.13
106 0.12
107 0.15
108 0.17
109 0.19
110 0.25
111 0.29
112 0.3
113 0.3
114 0.31
115 0.28
116 0.28
117 0.31
118 0.3
119 0.27
120 0.29
121 0.27
122 0.25
123 0.24