Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IT91

Protein Details
Accession A0A3N4IT91    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
122-150LPHDSARHGRWCKRNKLHCRNPKQIFEGGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences MASMAEAEDGLLAGRSAQRYDQQVATGPTVGEERDRSSRTRNGGLLRDCHDGVRKTALQPPGELSLLHSLNTLTIGMNEELERLGESNNLTTQKSTHMTPVILYPPVRQYLNKDHPGPGLSLPHDSARHGRWCKRNKLHCRNPKQIFEGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.11
4 0.13
5 0.17
6 0.22
7 0.26
8 0.26
9 0.25
10 0.28
11 0.29
12 0.29
13 0.25
14 0.2
15 0.18
16 0.17
17 0.16
18 0.14
19 0.13
20 0.15
21 0.2
22 0.22
23 0.24
24 0.29
25 0.35
26 0.37
27 0.4
28 0.4
29 0.39
30 0.45
31 0.45
32 0.43
33 0.41
34 0.4
35 0.35
36 0.33
37 0.33
38 0.27
39 0.25
40 0.27
41 0.24
42 0.23
43 0.28
44 0.31
45 0.27
46 0.26
47 0.27
48 0.23
49 0.22
50 0.2
51 0.16
52 0.16
53 0.16
54 0.16
55 0.14
56 0.11
57 0.11
58 0.11
59 0.1
60 0.04
61 0.04
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.04
71 0.04
72 0.05
73 0.06
74 0.07
75 0.09
76 0.11
77 0.11
78 0.11
79 0.11
80 0.14
81 0.16
82 0.16
83 0.16
84 0.17
85 0.17
86 0.17
87 0.19
88 0.17
89 0.18
90 0.17
91 0.16
92 0.17
93 0.2
94 0.21
95 0.19
96 0.23
97 0.32
98 0.4
99 0.45
100 0.44
101 0.43
102 0.44
103 0.45
104 0.4
105 0.32
106 0.27
107 0.22
108 0.22
109 0.22
110 0.24
111 0.23
112 0.24
113 0.26
114 0.27
115 0.35
116 0.4
117 0.47
118 0.53
119 0.62
120 0.71
121 0.77
122 0.83
123 0.84
124 0.89
125 0.91
126 0.92
127 0.93
128 0.92
129 0.9
130 0.88
131 0.81