Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4I9Z7

Protein Details
Accession A0A3N4I9Z7    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-53IGNRSSKKLARRSRLKGNKQLRIHRKNQRRDRRRKAAAVGBasic
NLS Segment(s)
PositionSequence
17-54RSSKKLARRSRLKGNKQLRIHRKNQRRDRRRKAAAVGK
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016641  EGD2/NACA  
IPR044034  NAC-like_UBA  
Gene Ontology GO:0005854  C:nascent polypeptide-associated complex  
Pfam View protein in Pfam  
PF19026  HYPK_UBA  
CDD cd14358  UBA_NAC_euk  
Amino Acid Sequences MEHKAVRTTPKTVIGNRSSKKLARRSRLKGNKQLRIHRKNQRRDRRRKAAAVGKDLKAALRAEEGLDPRDIELVMSQADCSRKRAVHALLEHDQDIVNAIMGLYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.57
4 0.58
5 0.55
6 0.54
7 0.57
8 0.59
9 0.61
10 0.61
11 0.69
12 0.71
13 0.77
14 0.83
15 0.84
16 0.84
17 0.84
18 0.83
19 0.81
20 0.84
21 0.84
22 0.81
23 0.81
24 0.81
25 0.81
26 0.82
27 0.85
28 0.86
29 0.86
30 0.89
31 0.91
32 0.91
33 0.88
34 0.83
35 0.79
36 0.76
37 0.71
38 0.68
39 0.61
40 0.51
41 0.45
42 0.4
43 0.32
44 0.26
45 0.21
46 0.13
47 0.1
48 0.09
49 0.09
50 0.11
51 0.12
52 0.11
53 0.12
54 0.11
55 0.1
56 0.11
57 0.1
58 0.07
59 0.07
60 0.06
61 0.06
62 0.06
63 0.06
64 0.09
65 0.13
66 0.15
67 0.18
68 0.22
69 0.22
70 0.25
71 0.32
72 0.33
73 0.37
74 0.39
75 0.43
76 0.43
77 0.44
78 0.41
79 0.35
80 0.31
81 0.23
82 0.21
83 0.14
84 0.1
85 0.07