Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HBT7

Protein Details
Accession A0A3N4HBT7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
87-118PRSSEVNRLRRDRRSRKGRKRDKSGRVDSGQPBasic
NLS Segment(s)
PositionSequence
94-111RLRRDRRSRKGRKRDKSG
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
Amino Acid Sequences MKTRIGKLRANRQLMEKGAPAHQKETLPELETLPTPDADLPDHEADTADTDTYENTPSAESQDEAESAPNQKRPRTSGAGLPVASNPRSSEVNRLRRDRRSRKGRKRDKSGRVDSGQPAPAQSTPAPTVED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.53
3 0.44
4 0.38
5 0.38
6 0.42
7 0.39
8 0.35
9 0.35
10 0.33
11 0.32
12 0.34
13 0.3
14 0.26
15 0.24
16 0.23
17 0.21
18 0.2
19 0.2
20 0.16
21 0.14
22 0.12
23 0.12
24 0.12
25 0.11
26 0.12
27 0.14
28 0.14
29 0.14
30 0.13
31 0.12
32 0.12
33 0.13
34 0.12
35 0.08
36 0.07
37 0.07
38 0.07
39 0.08
40 0.08
41 0.06
42 0.06
43 0.07
44 0.07
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.09
53 0.08
54 0.1
55 0.12
56 0.16
57 0.18
58 0.2
59 0.22
60 0.25
61 0.3
62 0.33
63 0.32
64 0.32
65 0.35
66 0.37
67 0.34
68 0.31
69 0.27
70 0.25
71 0.23
72 0.19
73 0.15
74 0.14
75 0.16
76 0.17
77 0.25
78 0.32
79 0.42
80 0.48
81 0.56
82 0.6
83 0.67
84 0.77
85 0.78
86 0.79
87 0.8
88 0.85
89 0.88
90 0.93
91 0.94
92 0.94
93 0.94
94 0.94
95 0.93
96 0.93
97 0.9
98 0.88
99 0.8
100 0.76
101 0.69
102 0.64
103 0.57
104 0.46
105 0.38
106 0.32
107 0.29
108 0.28
109 0.24
110 0.23
111 0.22