Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4HNW0

Protein Details
Accession A0A3N4HNW0   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
91-119ILEKKNGDKKKTKTQSSKKSKKESEGFVFHydrophilic
NLS Segment(s)
PositionSequence
36-50PVPAKVTKTKAKKKE
69-112LKKIGLKDRGLGKKEEGDVRVKILEKKNGDKKKTKTQSSKKSKK
Subcellular Location(s) mito 20.5, mito_nucl 12.5, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MAPSTQALTTLAVTSLLNRRARRQQKATAAVDPIKPVPAKVTKTKAKKKEEVVVRKEDQAGLSTVEKNLKKIGLKDRGLGKKEEGDVRVKILEKKNGDKKKTKTQSSKKSKKESEGFVFASEDDDSDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.18
3 0.24
4 0.29
5 0.31
6 0.37
7 0.47
8 0.57
9 0.63
10 0.64
11 0.66
12 0.7
13 0.77
14 0.74
15 0.67
16 0.62
17 0.55
18 0.49
19 0.42
20 0.33
21 0.27
22 0.24
23 0.2
24 0.21
25 0.23
26 0.27
27 0.32
28 0.39
29 0.44
30 0.55
31 0.64
32 0.68
33 0.7
34 0.73
35 0.71
36 0.71
37 0.72
38 0.72
39 0.67
40 0.65
41 0.58
42 0.53
43 0.49
44 0.41
45 0.31
46 0.23
47 0.18
48 0.12
49 0.12
50 0.11
51 0.11
52 0.16
53 0.16
54 0.15
55 0.16
56 0.17
57 0.17
58 0.22
59 0.3
60 0.33
61 0.34
62 0.38
63 0.45
64 0.5
65 0.5
66 0.46
67 0.39
68 0.34
69 0.36
70 0.35
71 0.29
72 0.26
73 0.25
74 0.25
75 0.26
76 0.24
77 0.28
78 0.3
79 0.35
80 0.36
81 0.44
82 0.53
83 0.59
84 0.65
85 0.67
86 0.69
87 0.73
88 0.78
89 0.79
90 0.8
91 0.82
92 0.86
93 0.88
94 0.92
95 0.9
96 0.91
97 0.88
98 0.86
99 0.83
100 0.81
101 0.77
102 0.74
103 0.65
104 0.56
105 0.5
106 0.4
107 0.34
108 0.25
109 0.18