Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4HXM2

Protein Details
Accession A0A3N4HXM2    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
28-55VSGASNASRRRKNRRKNQKARQQQLQPIHydrophilic
NLS Segment(s)
PositionSequence
35-47SRRRKNRRKNQKA
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MSQAQAQQQRGFVEEAEDSRSDFGGSSVSGASNASRRRKNRRKNQKARQQQLQPINQGQALAPPPQEKKNNKDAMSLRLDINLEAELSLRVKVHGDVTLALL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.18
4 0.17
5 0.15
6 0.15
7 0.15
8 0.13
9 0.11
10 0.1
11 0.08
12 0.07
13 0.08
14 0.07
15 0.07
16 0.07
17 0.07
18 0.08
19 0.12
20 0.19
21 0.25
22 0.32
23 0.39
24 0.51
25 0.61
26 0.71
27 0.76
28 0.82
29 0.86
30 0.9
31 0.93
32 0.93
33 0.93
34 0.89
35 0.87
36 0.82
37 0.78
38 0.75
39 0.68
40 0.6
41 0.51
42 0.45
43 0.36
44 0.29
45 0.22
46 0.17
47 0.14
48 0.12
49 0.12
50 0.15
51 0.17
52 0.23
53 0.32
54 0.34
55 0.39
56 0.48
57 0.55
58 0.52
59 0.57
60 0.54
61 0.52
62 0.53
63 0.48
64 0.38
65 0.33
66 0.32
67 0.24
68 0.23
69 0.16
70 0.11
71 0.09
72 0.09
73 0.08
74 0.08
75 0.09
76 0.09
77 0.09
78 0.1
79 0.12
80 0.13
81 0.14
82 0.15