Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IMX9

Protein Details
Accession A0A3N4IMX9    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-48MTAVKRIPIVKKRTKKFARHQSHDYKCVDASWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
11-16KKRTKK
Subcellular Location(s) mito 17, cyto 7, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MTAVKRIPIVKKRTKKFARHQSHDYKCVDASWRKPKGIDNRVRRRFKGQLAMPSIGYGSNRKTRHLTPSGHKAFLVQNPADVELLLMHNKTFAAEIGHAVSSRKRVEIIAKAKALGVKVTNPKGRVTVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.86
4 0.87
5 0.88
6 0.86
7 0.87
8 0.87
9 0.85
10 0.82
11 0.73
12 0.64
13 0.53
14 0.48
15 0.45
16 0.4
17 0.41
18 0.44
19 0.48
20 0.46
21 0.48
22 0.53
23 0.57
24 0.61
25 0.62
26 0.62
27 0.68
28 0.77
29 0.82
30 0.77
31 0.73
32 0.69
33 0.65
34 0.63
35 0.57
36 0.55
37 0.53
38 0.52
39 0.44
40 0.38
41 0.32
42 0.23
43 0.2
44 0.13
45 0.12
46 0.19
47 0.19
48 0.21
49 0.25
50 0.26
51 0.33
52 0.38
53 0.38
54 0.36
55 0.46
56 0.47
57 0.44
58 0.41
59 0.36
60 0.32
61 0.31
62 0.31
63 0.2
64 0.18
65 0.18
66 0.19
67 0.18
68 0.14
69 0.11
70 0.07
71 0.08
72 0.08
73 0.07
74 0.06
75 0.07
76 0.07
77 0.07
78 0.07
79 0.06
80 0.07
81 0.08
82 0.09
83 0.1
84 0.11
85 0.11
86 0.12
87 0.13
88 0.17
89 0.17
90 0.17
91 0.17
92 0.18
93 0.24
94 0.33
95 0.37
96 0.39
97 0.39
98 0.39
99 0.39
100 0.39
101 0.34
102 0.28
103 0.23
104 0.23
105 0.31
106 0.39
107 0.43
108 0.43
109 0.44
110 0.45