Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8NXN5

Protein Details
Accession B8NXN5    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
2-31PGVPSNKACERCKKRHLKCDEARPKCQRCTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPGVPSNKACERCKKRHLKCDEARPKCQRCTNAGVDCPGYVQTRKFIDQGASVRRRYAPYQESHTKPHTSKGTETVNACSARTNMVTSKVLVPVKPILHFLRAGDLASRVNQALTHQPRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.84
4 0.87
5 0.87
6 0.86
7 0.88
8 0.88
9 0.84
10 0.84
11 0.84
12 0.82
13 0.79
14 0.76
15 0.7
16 0.64
17 0.64
18 0.62
19 0.58
20 0.53
21 0.48
22 0.42
23 0.37
24 0.31
25 0.26
26 0.2
27 0.16
28 0.15
29 0.17
30 0.19
31 0.21
32 0.21
33 0.2
34 0.19
35 0.22
36 0.25
37 0.3
38 0.32
39 0.3
40 0.31
41 0.32
42 0.33
43 0.3
44 0.32
45 0.28
46 0.26
47 0.33
48 0.39
49 0.4
50 0.42
51 0.44
52 0.41
53 0.37
54 0.41
55 0.39
56 0.35
57 0.34
58 0.35
59 0.36
60 0.35
61 0.35
62 0.31
63 0.31
64 0.29
65 0.27
66 0.22
67 0.18
68 0.17
69 0.17
70 0.16
71 0.13
72 0.17
73 0.18
74 0.18
75 0.2
76 0.23
77 0.24
78 0.22
79 0.24
80 0.24
81 0.25
82 0.25
83 0.28
84 0.24
85 0.25
86 0.26
87 0.24
88 0.24
89 0.22
90 0.22
91 0.19
92 0.18
93 0.17
94 0.18
95 0.2
96 0.14
97 0.14
98 0.14
99 0.15
100 0.24