Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8ND67

Protein Details
Accession B8ND67    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-68LTCGYCGRRRRGTTRTRRSRIHydrophilic
NLS Segment(s)
PositionSequence
57-65RRGTTRTRR
Subcellular Location(s) plas 16, vacu 5, mito 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGAVVSCIQSVFHAIGACLMGIVNTIGAVCKAIIDGVVTLFDVIISCLTCGYCGRRRRGTTRTRRSRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.09
5 0.07
6 0.06
7 0.04
8 0.04
9 0.04
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.04
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.04
32 0.04
33 0.04
34 0.04
35 0.05
36 0.06
37 0.08
38 0.14
39 0.21
40 0.28
41 0.37
42 0.45
43 0.52
44 0.59
45 0.68
46 0.73
47 0.76
48 0.8