Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9X4U6

Protein Details
Accession A0A4P9X4U6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
344-369SLARLAKERDRQGRRLRRGQRGAGYAHydrophilic
NLS Segment(s)
PositionSequence
352-362RDRQGRRLRRG
Subcellular Location(s) mito 24, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006939  SNF5  
Gene Ontology GO:0000228  C:nuclear chromosome  
GO:0070603  C:SWI/SNF superfamily-type complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF04855  SNF5  
Amino Acid Sequences MKRASLAHLSTPRMPRKVDPHTCRSPAVVLSFDSASSKTTLLHHAQAPVRLVPISLALELDGIKLDDAFLWNTAEQLVTPEHFAQLFIDDFDNVYPRHFVPLIAQSIRAQLSALEPAAVEELLPPSPTPSPAVLPPLDTPPGGPLEVAAASLASSASSPPPPPTSSSSAPPPPPARPTTTDAGAASLPPSDPGMKSEPRDAATATAVAAPTSPPPPTATALPAPFAAVPPPSTPLDDGERAIIRLNLHVGTLHLRDQFEWPLSPAAEGAITPECFAAMLAADVGIAGQFVPAIAVAIREQVAAARLQTGETARAPPLAPHKRPFRGEAVETEWQPDVRELDEESLARLAKERDRQGRRLRRGQRGAGYALAGYGGGAGGAGGGGYGLNARSLYGGIEGRRSSGFTGSYRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.56
3 0.59
4 0.66
5 0.69
6 0.68
7 0.69
8 0.74
9 0.75
10 0.69
11 0.62
12 0.54
13 0.47
14 0.42
15 0.35
16 0.27
17 0.26
18 0.24
19 0.22
20 0.2
21 0.17
22 0.15
23 0.15
24 0.14
25 0.13
26 0.15
27 0.21
28 0.24
29 0.28
30 0.29
31 0.35
32 0.37
33 0.39
34 0.39
35 0.34
36 0.31
37 0.26
38 0.24
39 0.17
40 0.17
41 0.15
42 0.12
43 0.11
44 0.1
45 0.1
46 0.1
47 0.1
48 0.08
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.08
55 0.08
56 0.09
57 0.1
58 0.1
59 0.11
60 0.11
61 0.1
62 0.08
63 0.1
64 0.1
65 0.09
66 0.12
67 0.12
68 0.13
69 0.13
70 0.13
71 0.11
72 0.12
73 0.11
74 0.1
75 0.1
76 0.09
77 0.1
78 0.1
79 0.12
80 0.1
81 0.11
82 0.12
83 0.12
84 0.16
85 0.16
86 0.16
87 0.17
88 0.23
89 0.28
90 0.26
91 0.27
92 0.23
93 0.26
94 0.27
95 0.22
96 0.16
97 0.11
98 0.12
99 0.13
100 0.12
101 0.09
102 0.08
103 0.08
104 0.09
105 0.08
106 0.07
107 0.05
108 0.07
109 0.07
110 0.07
111 0.07
112 0.08
113 0.09
114 0.1
115 0.12
116 0.12
117 0.13
118 0.15
119 0.19
120 0.17
121 0.18
122 0.19
123 0.19
124 0.19
125 0.17
126 0.16
127 0.14
128 0.15
129 0.13
130 0.11
131 0.08
132 0.08
133 0.08
134 0.08
135 0.06
136 0.04
137 0.04
138 0.05
139 0.04
140 0.03
141 0.03
142 0.04
143 0.06
144 0.07
145 0.08
146 0.1
147 0.13
148 0.14
149 0.17
150 0.21
151 0.26
152 0.27
153 0.29
154 0.32
155 0.34
156 0.34
157 0.37
158 0.35
159 0.32
160 0.34
161 0.34
162 0.33
163 0.32
164 0.35
165 0.32
166 0.3
167 0.29
168 0.25
169 0.23
170 0.19
171 0.14
172 0.11
173 0.08
174 0.07
175 0.06
176 0.06
177 0.06
178 0.06
179 0.09
180 0.13
181 0.16
182 0.17
183 0.2
184 0.22
185 0.22
186 0.23
187 0.2
188 0.17
189 0.15
190 0.13
191 0.1
192 0.09
193 0.07
194 0.06
195 0.06
196 0.05
197 0.06
198 0.07
199 0.07
200 0.07
201 0.08
202 0.1
203 0.12
204 0.12
205 0.14
206 0.16
207 0.16
208 0.16
209 0.15
210 0.13
211 0.12
212 0.11
213 0.09
214 0.07
215 0.08
216 0.07
217 0.1
218 0.1
219 0.11
220 0.12
221 0.13
222 0.16
223 0.16
224 0.16
225 0.15
226 0.15
227 0.14
228 0.14
229 0.14
230 0.11
231 0.1
232 0.11
233 0.09
234 0.09
235 0.09
236 0.09
237 0.1
238 0.11
239 0.13
240 0.14
241 0.14
242 0.15
243 0.18
244 0.19
245 0.17
246 0.17
247 0.15
248 0.14
249 0.14
250 0.13
251 0.11
252 0.09
253 0.08
254 0.07
255 0.08
256 0.09
257 0.08
258 0.09
259 0.09
260 0.08
261 0.08
262 0.08
263 0.06
264 0.03
265 0.04
266 0.03
267 0.03
268 0.03
269 0.03
270 0.03
271 0.02
272 0.02
273 0.02
274 0.02
275 0.02
276 0.02
277 0.02
278 0.02
279 0.03
280 0.03
281 0.04
282 0.04
283 0.06
284 0.06
285 0.06
286 0.06
287 0.06
288 0.08
289 0.07
290 0.08
291 0.08
292 0.08
293 0.08
294 0.1
295 0.11
296 0.12
297 0.13
298 0.15
299 0.14
300 0.16
301 0.16
302 0.17
303 0.27
304 0.34
305 0.38
306 0.43
307 0.52
308 0.57
309 0.6
310 0.62
311 0.58
312 0.55
313 0.52
314 0.49
315 0.46
316 0.45
317 0.42
318 0.4
319 0.33
320 0.27
321 0.26
322 0.23
323 0.17
324 0.13
325 0.15
326 0.13
327 0.15
328 0.17
329 0.16
330 0.16
331 0.17
332 0.16
333 0.15
334 0.17
335 0.18
336 0.23
337 0.31
338 0.39
339 0.46
340 0.54
341 0.63
342 0.71
343 0.78
344 0.81
345 0.83
346 0.84
347 0.85
348 0.86
349 0.85
350 0.82
351 0.75
352 0.68
353 0.59
354 0.5
355 0.39
356 0.3
357 0.22
358 0.14
359 0.09
360 0.06
361 0.04
362 0.03
363 0.03
364 0.03
365 0.02
366 0.02
367 0.02
368 0.02
369 0.02
370 0.02
371 0.02
372 0.04
373 0.04
374 0.05
375 0.06
376 0.06
377 0.07
378 0.07
379 0.08
380 0.11
381 0.15
382 0.15
383 0.21
384 0.21
385 0.23
386 0.24
387 0.25
388 0.23
389 0.23
390 0.25