Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9X4D5

Protein Details
Accession A0A4P9X4D5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
52-72QSRALKARGKGKKQDKVAKARBasic
NLS Segment(s)
PositionSequence
56-72LKARGKGKKQDKVAKAR
Subcellular Location(s) nucl 13, mito 7.5, cyto_mito 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MMEAQRIDEGRRMFQVFAARMFELRVMAAYHAWAAEQRREQFLKELEAEENQSRALKARGKGKKQDKVAKAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.27
4 0.27
5 0.27
6 0.23
7 0.22
8 0.22
9 0.19
10 0.13
11 0.11
12 0.1
13 0.07
14 0.07
15 0.07
16 0.07
17 0.06
18 0.06
19 0.06
20 0.07
21 0.08
22 0.11
23 0.14
24 0.16
25 0.2
26 0.21
27 0.21
28 0.24
29 0.24
30 0.23
31 0.21
32 0.21
33 0.18
34 0.19
35 0.22
36 0.18
37 0.17
38 0.15
39 0.14
40 0.13
41 0.14
42 0.18
43 0.21
44 0.25
45 0.35
46 0.44
47 0.51
48 0.62
49 0.7
50 0.74
51 0.78
52 0.83