Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9X868

Protein Details
Accession A0A4P9X868    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
625-650SKSSEKHTSHRPQSQQQPQQQRQSQQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR030379  G_SEPTIN_dom  
IPR027417  P-loop_NTPase  
IPR036028  SH3-like_dom_sf  
IPR001452  SH3_domain  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF00735  Septin  
PF14604  SH3_9  
PROSITE View protein in PROSITE  
PS51719  G_SEPTIN  
PS50002  SH3  
CDD cd00174  SH3  
Amino Acid Sequences MSSTHGSPGIAPGADPAAAHAAAPSNAPPDAPPASAPASARDGKYIVIAPYVPAHSDEIKLAVGDQIVILHMYDDGWVLGRNDTTSAIGLLPHNFLTPATTVGVDETKPAPKAAGADRTSQSSSETPSDTSRVSYQSGVSSHGDDEGDDDRRRSRGARAEEAASPVAPLPSQPQQPSAIGAYLGIPAVIPIVSQRRTSLMSQDRPLDRSSLATPPATPLTKKAIAGAAAAAAADHRGGGAESMASGFVGGAYRKLAAAPAAEPALTTLRGAAPATTKSTAAAAATTAAVATAPALSESERRAQTQAKFERIRDLRRDRAPLASHIGCLKIAIVGDSGIGKTSLIRHFLSIDEVTGHEPLTDANELDLQEPAEYIREVRASTIEESEATAAAAPNPSVATITPPEPFNLTFVDTPGFGAHMNAMVAIQPIINYHFAAFRQTDRYFTRSRPIPQLVRFLNSGSGAHNHVDICIYGILHRLKPVDIEFMRQLSPLVSLVPVILKSDTLKQSEVFSLKCNMLEALRRYNIKIHGFGMTLDELTVLAKAGVTGAPPFAISNPDAAVQVASRDAAPTFINEFDELKSVILYHHIHELRHLTAEKFVAWREHTMGLAAQRPSPDKTSNASSSKSSEKHTSHRPQSQQQPQQQRQSQQPQQSLLQQHQQYTQQQSLHLQSQSQSQSQSQSQSQSNRPSMIPAAAAPNSRPSSMLPNEASYPAASPSAMPSESARSSKMNKADLVLGRLPGNPAYASSTSLTTPTPKNDHKPPKFLGMFKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.12
4 0.12
5 0.12
6 0.12
7 0.12
8 0.13
9 0.13
10 0.14
11 0.14
12 0.13
13 0.13
14 0.14
15 0.13
16 0.16
17 0.19
18 0.19
19 0.18
20 0.19
21 0.22
22 0.25
23 0.25
24 0.23
25 0.27
26 0.3
27 0.3
28 0.29
29 0.26
30 0.24
31 0.26
32 0.26
33 0.2
34 0.19
35 0.18
36 0.17
37 0.2
38 0.21
39 0.19
40 0.17
41 0.19
42 0.19
43 0.2
44 0.19
45 0.17
46 0.16
47 0.16
48 0.14
49 0.13
50 0.11
51 0.1
52 0.09
53 0.07
54 0.07
55 0.08
56 0.07
57 0.06
58 0.06
59 0.05
60 0.06
61 0.06
62 0.05
63 0.06
64 0.08
65 0.09
66 0.1
67 0.11
68 0.11
69 0.12
70 0.13
71 0.13
72 0.12
73 0.12
74 0.11
75 0.12
76 0.13
77 0.14
78 0.14
79 0.14
80 0.13
81 0.13
82 0.12
83 0.13
84 0.12
85 0.12
86 0.11
87 0.11
88 0.11
89 0.13
90 0.15
91 0.12
92 0.14
93 0.15
94 0.18
95 0.19
96 0.19
97 0.18
98 0.17
99 0.21
100 0.25
101 0.31
102 0.29
103 0.34
104 0.36
105 0.39
106 0.39
107 0.35
108 0.33
109 0.25
110 0.27
111 0.24
112 0.25
113 0.22
114 0.24
115 0.26
116 0.23
117 0.24
118 0.23
119 0.22
120 0.22
121 0.22
122 0.21
123 0.22
124 0.22
125 0.24
126 0.22
127 0.21
128 0.19
129 0.19
130 0.18
131 0.14
132 0.15
133 0.15
134 0.19
135 0.19
136 0.2
137 0.21
138 0.23
139 0.25
140 0.24
141 0.28
142 0.31
143 0.38
144 0.43
145 0.44
146 0.46
147 0.45
148 0.46
149 0.39
150 0.3
151 0.23
152 0.17
153 0.14
154 0.11
155 0.1
156 0.11
157 0.16
158 0.22
159 0.22
160 0.25
161 0.27
162 0.28
163 0.29
164 0.26
165 0.2
166 0.15
167 0.14
168 0.12
169 0.1
170 0.09
171 0.07
172 0.05
173 0.04
174 0.05
175 0.04
176 0.04
177 0.06
178 0.12
179 0.14
180 0.15
181 0.16
182 0.18
183 0.22
184 0.23
185 0.3
186 0.33
187 0.36
188 0.39
189 0.46
190 0.45
191 0.44
192 0.44
193 0.37
194 0.28
195 0.25
196 0.25
197 0.22
198 0.21
199 0.2
200 0.19
201 0.2
202 0.24
203 0.23
204 0.21
205 0.2
206 0.25
207 0.27
208 0.27
209 0.26
210 0.23
211 0.22
212 0.22
213 0.19
214 0.12
215 0.09
216 0.09
217 0.07
218 0.04
219 0.04
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.04
227 0.03
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.03
234 0.03
235 0.05
236 0.05
237 0.05
238 0.06
239 0.06
240 0.06
241 0.07
242 0.07
243 0.07
244 0.08
245 0.07
246 0.08
247 0.08
248 0.08
249 0.08
250 0.09
251 0.09
252 0.08
253 0.08
254 0.07
255 0.07
256 0.08
257 0.09
258 0.08
259 0.09
260 0.1
261 0.14
262 0.14
263 0.13
264 0.13
265 0.13
266 0.13
267 0.11
268 0.09
269 0.06
270 0.06
271 0.06
272 0.05
273 0.04
274 0.04
275 0.03
276 0.03
277 0.03
278 0.03
279 0.03
280 0.03
281 0.03
282 0.04
283 0.06
284 0.08
285 0.14
286 0.15
287 0.17
288 0.19
289 0.24
290 0.27
291 0.36
292 0.39
293 0.42
294 0.44
295 0.43
296 0.5
297 0.49
298 0.52
299 0.51
300 0.53
301 0.52
302 0.55
303 0.59
304 0.5
305 0.52
306 0.47
307 0.4
308 0.4
309 0.32
310 0.28
311 0.24
312 0.23
313 0.17
314 0.15
315 0.13
316 0.07
317 0.06
318 0.06
319 0.05
320 0.05
321 0.05
322 0.05
323 0.05
324 0.04
325 0.04
326 0.04
327 0.04
328 0.09
329 0.11
330 0.13
331 0.14
332 0.14
333 0.15
334 0.15
335 0.18
336 0.13
337 0.12
338 0.09
339 0.09
340 0.1
341 0.09
342 0.09
343 0.06
344 0.06
345 0.06
346 0.07
347 0.07
348 0.06
349 0.06
350 0.08
351 0.08
352 0.09
353 0.09
354 0.07
355 0.06
356 0.06
357 0.06
358 0.05
359 0.05
360 0.05
361 0.06
362 0.06
363 0.07
364 0.07
365 0.08
366 0.09
367 0.1
368 0.1
369 0.09
370 0.08
371 0.09
372 0.09
373 0.07
374 0.06
375 0.05
376 0.04
377 0.04
378 0.05
379 0.04
380 0.04
381 0.04
382 0.04
383 0.04
384 0.04
385 0.06
386 0.07
387 0.09
388 0.1
389 0.1
390 0.11
391 0.12
392 0.12
393 0.11
394 0.11
395 0.12
396 0.1
397 0.11
398 0.11
399 0.09
400 0.09
401 0.08
402 0.08
403 0.06
404 0.06
405 0.05
406 0.05
407 0.05
408 0.04
409 0.04
410 0.04
411 0.04
412 0.04
413 0.04
414 0.03
415 0.04
416 0.06
417 0.06
418 0.06
419 0.06
420 0.08
421 0.08
422 0.11
423 0.11
424 0.12
425 0.17
426 0.17
427 0.22
428 0.23
429 0.27
430 0.27
431 0.28
432 0.34
433 0.33
434 0.36
435 0.39
436 0.43
437 0.45
438 0.45
439 0.52
440 0.45
441 0.42
442 0.39
443 0.32
444 0.27
445 0.22
446 0.19
447 0.12
448 0.13
449 0.12
450 0.12
451 0.12
452 0.11
453 0.1
454 0.1
455 0.09
456 0.08
457 0.07
458 0.07
459 0.06
460 0.11
461 0.13
462 0.13
463 0.15
464 0.14
465 0.14
466 0.16
467 0.16
468 0.19
469 0.18
470 0.21
471 0.21
472 0.21
473 0.22
474 0.2
475 0.19
476 0.12
477 0.12
478 0.09
479 0.08
480 0.06
481 0.06
482 0.06
483 0.07
484 0.06
485 0.06
486 0.06
487 0.06
488 0.08
489 0.14
490 0.17
491 0.18
492 0.19
493 0.19
494 0.21
495 0.24
496 0.25
497 0.19
498 0.18
499 0.19
500 0.19
501 0.18
502 0.17
503 0.14
504 0.14
505 0.19
506 0.2
507 0.24
508 0.27
509 0.28
510 0.28
511 0.32
512 0.37
513 0.34
514 0.32
515 0.27
516 0.26
517 0.25
518 0.24
519 0.22
520 0.16
521 0.13
522 0.11
523 0.09
524 0.07
525 0.07
526 0.07
527 0.04
528 0.04
529 0.04
530 0.03
531 0.04
532 0.04
533 0.05
534 0.05
535 0.05
536 0.05
537 0.06
538 0.06
539 0.06
540 0.08
541 0.08
542 0.09
543 0.09
544 0.1
545 0.1
546 0.1
547 0.1
548 0.08
549 0.08
550 0.07
551 0.07
552 0.06
553 0.07
554 0.06
555 0.08
556 0.08
557 0.09
558 0.1
559 0.11
560 0.12
561 0.12
562 0.13
563 0.13
564 0.14
565 0.13
566 0.11
567 0.1
568 0.09
569 0.09
570 0.13
571 0.13
572 0.13
573 0.21
574 0.22
575 0.22
576 0.25
577 0.28
578 0.24
579 0.27
580 0.27
581 0.2
582 0.21
583 0.22
584 0.21
585 0.19
586 0.19
587 0.2
588 0.2
589 0.22
590 0.21
591 0.22
592 0.2
593 0.2
594 0.2
595 0.18
596 0.22
597 0.21
598 0.19
599 0.21
600 0.23
601 0.26
602 0.28
603 0.28
604 0.26
605 0.29
606 0.35
607 0.39
608 0.4
609 0.4
610 0.37
611 0.38
612 0.43
613 0.41
614 0.39
615 0.4
616 0.41
617 0.46
618 0.55
619 0.61
620 0.63
621 0.69
622 0.72
623 0.72
624 0.78
625 0.82
626 0.81
627 0.8
628 0.82
629 0.81
630 0.83
631 0.81
632 0.76
633 0.75
634 0.76
635 0.75
636 0.72
637 0.7
638 0.63
639 0.6
640 0.61
641 0.56
642 0.5
643 0.51
644 0.45
645 0.42
646 0.42
647 0.45
648 0.44
649 0.46
650 0.46
651 0.39
652 0.39
653 0.41
654 0.41
655 0.41
656 0.36
657 0.31
658 0.27
659 0.33
660 0.35
661 0.33
662 0.31
663 0.27
664 0.32
665 0.33
666 0.38
667 0.33
668 0.35
669 0.39
670 0.44
671 0.49
672 0.53
673 0.53
674 0.51
675 0.48
676 0.46
677 0.42
678 0.36
679 0.3
680 0.22
681 0.24
682 0.24
683 0.25
684 0.22
685 0.28
686 0.29
687 0.28
688 0.27
689 0.24
690 0.3
691 0.32
692 0.38
693 0.32
694 0.33
695 0.35
696 0.35
697 0.34
698 0.25
699 0.23
700 0.17
701 0.16
702 0.13
703 0.11
704 0.13
705 0.17
706 0.16
707 0.16
708 0.17
709 0.22
710 0.26
711 0.28
712 0.27
713 0.28
714 0.33
715 0.39
716 0.44
717 0.43
718 0.4
719 0.41
720 0.46
721 0.45
722 0.46
723 0.41
724 0.36
725 0.33
726 0.32
727 0.32
728 0.25
729 0.23
730 0.17
731 0.16
732 0.2
733 0.19
734 0.21
735 0.2
736 0.21
737 0.19
738 0.21
739 0.21
740 0.21
741 0.25
742 0.3
743 0.37
744 0.43
745 0.51
746 0.6
747 0.7
748 0.72
749 0.76
750 0.73
751 0.75
752 0.73