Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NI72

Protein Details
Accession B8NI72   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
72-96GSTVEYRRKHCKYPKRNRYVGPGSYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9, cyto_nucl 8, mito 6, nucl 5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011118  Tannase/feruloyl_esterase  
Gene Ontology GO:0052689  F:carboxylic ester hydrolase activity  
Pfam View protein in Pfam  
PF07519  Tannase  
Amino Acid Sequences MNLSPSELDSFYRFFPISGMAHCANADGPSAIGQGTGTFAGNNPQDNVLLAMVQWVEEGVAPDFVRGAKLNGSTVEYRRKHCKYPKRNRYVGPGSYTDENAWECV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.18
4 0.17
5 0.16
6 0.21
7 0.18
8 0.18
9 0.18
10 0.18
11 0.14
12 0.13
13 0.13
14 0.07
15 0.07
16 0.07
17 0.07
18 0.06
19 0.06
20 0.05
21 0.05
22 0.05
23 0.06
24 0.05
25 0.05
26 0.05
27 0.09
28 0.11
29 0.11
30 0.11
31 0.11
32 0.11
33 0.11
34 0.12
35 0.07
36 0.06
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.04
46 0.04
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.08
55 0.09
56 0.1
57 0.11
58 0.12
59 0.15
60 0.16
61 0.2
62 0.28
63 0.3
64 0.34
65 0.43
66 0.46
67 0.53
68 0.6
69 0.68
70 0.69
71 0.78
72 0.84
73 0.84
74 0.88
75 0.84
76 0.84
77 0.81
78 0.76
79 0.7
80 0.62
81 0.56
82 0.51
83 0.47
84 0.38
85 0.32