Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XDE3

Protein Details
Accession A0A4P9XDE3    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
611-635VDSGPSVAPKKRRQHKVPSGVPAHLHydrophilic
NLS Segment(s)
PositionSequence
619-675PKKRRQHKVPSGVPAHLRGRPDPERWLPKASRKAVPAGRKHMGKKAGAKPAKKVSRT
Subcellular Location(s) mito 15, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR026270  SRP72  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Amino Acid Sequences MVGPARKPAGSKSGKGTPKNPTDITPGVAALYRELADICAKEEEVPPAKIVAAADADAAITKIIALCTLDKIKAALEALDRVEKAAQITAQYQPTLHFLRSYLLYRLNRCSEALAFLQAIPHEIPSGLTEAIRLLELQILYKSETSWPRALELMGELLNSTTDETHIDAADMRLNYVAVKTNALMALAKLPQPADFEHEVLKDEGYEMFYNRACLAVACGDWDEAATLLERAAEACRAVAAETSDPLLRSEIDMIETQQLYIASRLQNGSLAESQVIQLRRLWKTTLDHQVRAVSLNNLHAAQQADPGALLVESSLAKLDAMPYKDKLNASQRMLGVHNQAATLFKFGETLCAKNEMLRAKTCFPLETRRADPSCGTVSAAIQGAKVLSKQATYTKGPSVTTKAKSWITSPTHSLGSLLTKVRALAHGNASDYRVALTLVKRLLKRYVDAQAAHLLPGLYNLKAWLHTRVGDRAGVESTLDEAATTCAAVGATAASDAFMKRREVFTRHVAPSRRAVKLLQRAVARGADAETLATYSGMLAARSRFRAGAVSHARWRQTLRAEHAIPWPPTWITPLPNEAVDALERNHRAPIKRSAPPPPRDDAAAEPMDVDSGPSVAPKKRRQHKVPSGVPAHLRGRPDPERWLPKASRKAVPAGRKHMGKKAGAKPAKKVSRTRATQGFSHSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.62
3 0.64
4 0.64
5 0.66
6 0.69
7 0.64
8 0.58
9 0.57
10 0.53
11 0.49
12 0.4
13 0.32
14 0.25
15 0.25
16 0.22
17 0.16
18 0.15
19 0.13
20 0.12
21 0.12
22 0.13
23 0.14
24 0.14
25 0.15
26 0.15
27 0.15
28 0.17
29 0.19
30 0.25
31 0.27
32 0.28
33 0.26
34 0.25
35 0.25
36 0.24
37 0.22
38 0.17
39 0.13
40 0.12
41 0.11
42 0.1
43 0.1
44 0.08
45 0.09
46 0.06
47 0.04
48 0.04
49 0.05
50 0.05
51 0.06
52 0.08
53 0.09
54 0.14
55 0.17
56 0.18
57 0.17
58 0.18
59 0.18
60 0.19
61 0.18
62 0.16
63 0.15
64 0.17
65 0.19
66 0.22
67 0.21
68 0.2
69 0.2
70 0.18
71 0.17
72 0.17
73 0.15
74 0.14
75 0.17
76 0.21
77 0.22
78 0.22
79 0.21
80 0.2
81 0.24
82 0.25
83 0.23
84 0.19
85 0.18
86 0.2
87 0.24
88 0.25
89 0.24
90 0.3
91 0.34
92 0.37
93 0.43
94 0.45
95 0.42
96 0.4
97 0.39
98 0.31
99 0.3
100 0.27
101 0.22
102 0.18
103 0.17
104 0.18
105 0.15
106 0.16
107 0.12
108 0.12
109 0.1
110 0.09
111 0.1
112 0.09
113 0.12
114 0.1
115 0.09
116 0.09
117 0.09
118 0.1
119 0.09
120 0.08
121 0.06
122 0.09
123 0.09
124 0.1
125 0.1
126 0.11
127 0.12
128 0.13
129 0.13
130 0.17
131 0.21
132 0.25
133 0.27
134 0.27
135 0.27
136 0.28
137 0.27
138 0.21
139 0.18
140 0.15
141 0.11
142 0.11
143 0.09
144 0.08
145 0.08
146 0.07
147 0.07
148 0.05
149 0.06
150 0.07
151 0.08
152 0.09
153 0.09
154 0.09
155 0.09
156 0.09
157 0.13
158 0.12
159 0.11
160 0.1
161 0.1
162 0.1
163 0.11
164 0.15
165 0.11
166 0.12
167 0.12
168 0.13
169 0.14
170 0.14
171 0.13
172 0.09
173 0.11
174 0.12
175 0.13
176 0.12
177 0.12
178 0.13
179 0.14
180 0.15
181 0.17
182 0.18
183 0.17
184 0.19
185 0.19
186 0.2
187 0.19
188 0.18
189 0.12
190 0.11
191 0.1
192 0.11
193 0.11
194 0.1
195 0.12
196 0.12
197 0.14
198 0.13
199 0.13
200 0.1
201 0.09
202 0.1
203 0.09
204 0.08
205 0.08
206 0.09
207 0.08
208 0.08
209 0.08
210 0.06
211 0.05
212 0.05
213 0.05
214 0.04
215 0.04
216 0.04
217 0.04
218 0.05
219 0.05
220 0.06
221 0.05
222 0.05
223 0.05
224 0.06
225 0.06
226 0.06
227 0.07
228 0.07
229 0.07
230 0.09
231 0.09
232 0.09
233 0.1
234 0.1
235 0.08
236 0.08
237 0.09
238 0.08
239 0.09
240 0.09
241 0.1
242 0.12
243 0.12
244 0.11
245 0.11
246 0.11
247 0.09
248 0.1
249 0.12
250 0.1
251 0.11
252 0.12
253 0.11
254 0.13
255 0.13
256 0.15
257 0.13
258 0.12
259 0.11
260 0.11
261 0.11
262 0.13
263 0.14
264 0.12
265 0.13
266 0.19
267 0.2
268 0.21
269 0.22
270 0.21
271 0.24
272 0.3
273 0.39
274 0.37
275 0.36
276 0.36
277 0.37
278 0.33
279 0.31
280 0.25
281 0.16
282 0.14
283 0.14
284 0.13
285 0.12
286 0.12
287 0.12
288 0.12
289 0.11
290 0.11
291 0.1
292 0.09
293 0.09
294 0.08
295 0.06
296 0.05
297 0.05
298 0.03
299 0.03
300 0.04
301 0.04
302 0.04
303 0.04
304 0.04
305 0.04
306 0.06
307 0.09
308 0.11
309 0.13
310 0.14
311 0.15
312 0.18
313 0.19
314 0.21
315 0.26
316 0.3
317 0.3
318 0.34
319 0.32
320 0.32
321 0.33
322 0.29
323 0.23
324 0.18
325 0.17
326 0.12
327 0.12
328 0.11
329 0.1
330 0.09
331 0.07
332 0.06
333 0.07
334 0.07
335 0.13
336 0.13
337 0.14
338 0.14
339 0.17
340 0.17
341 0.17
342 0.21
343 0.18
344 0.19
345 0.21
346 0.23
347 0.22
348 0.25
349 0.24
350 0.21
351 0.2
352 0.26
353 0.27
354 0.29
355 0.3
356 0.33
357 0.34
358 0.34
359 0.32
360 0.27
361 0.25
362 0.2
363 0.18
364 0.12
365 0.12
366 0.12
367 0.13
368 0.09
369 0.07
370 0.07
371 0.07
372 0.07
373 0.07
374 0.07
375 0.06
376 0.06
377 0.08
378 0.11
379 0.16
380 0.17
381 0.2
382 0.22
383 0.23
384 0.24
385 0.24
386 0.27
387 0.29
388 0.3
389 0.29
390 0.31
391 0.31
392 0.31
393 0.3
394 0.33
395 0.31
396 0.3
397 0.31
398 0.29
399 0.27
400 0.27
401 0.25
402 0.17
403 0.15
404 0.16
405 0.15
406 0.13
407 0.12
408 0.13
409 0.13
410 0.15
411 0.14
412 0.14
413 0.17
414 0.17
415 0.19
416 0.19
417 0.19
418 0.17
419 0.15
420 0.13
421 0.09
422 0.08
423 0.1
424 0.1
425 0.13
426 0.16
427 0.2
428 0.21
429 0.23
430 0.28
431 0.27
432 0.28
433 0.29
434 0.32
435 0.32
436 0.31
437 0.31
438 0.3
439 0.28
440 0.27
441 0.23
442 0.17
443 0.12
444 0.15
445 0.14
446 0.09
447 0.09
448 0.1
449 0.1
450 0.12
451 0.13
452 0.14
453 0.15
454 0.18
455 0.21
456 0.24
457 0.25
458 0.24
459 0.23
460 0.2
461 0.19
462 0.16
463 0.13
464 0.1
465 0.1
466 0.08
467 0.08
468 0.06
469 0.06
470 0.06
471 0.06
472 0.06
473 0.04
474 0.04
475 0.04
476 0.04
477 0.04
478 0.03
479 0.03
480 0.03
481 0.03
482 0.03
483 0.04
484 0.05
485 0.07
486 0.09
487 0.12
488 0.14
489 0.19
490 0.23
491 0.27
492 0.32
493 0.38
494 0.45
495 0.47
496 0.52
497 0.51
498 0.49
499 0.55
500 0.56
501 0.5
502 0.42
503 0.41
504 0.43
505 0.49
506 0.51
507 0.47
508 0.42
509 0.41
510 0.42
511 0.4
512 0.31
513 0.22
514 0.17
515 0.13
516 0.11
517 0.1
518 0.08
519 0.07
520 0.07
521 0.06
522 0.05
523 0.04
524 0.07
525 0.07
526 0.07
527 0.09
528 0.12
529 0.16
530 0.18
531 0.19
532 0.17
533 0.17
534 0.22
535 0.21
536 0.28
537 0.32
538 0.35
539 0.4
540 0.44
541 0.45
542 0.43
543 0.45
544 0.41
545 0.41
546 0.44
547 0.44
548 0.49
549 0.49
550 0.5
551 0.54
552 0.56
553 0.49
554 0.42
555 0.38
556 0.3
557 0.28
558 0.3
559 0.26
560 0.21
561 0.23
562 0.26
563 0.25
564 0.25
565 0.25
566 0.2
567 0.19
568 0.17
569 0.15
570 0.13
571 0.18
572 0.19
573 0.19
574 0.25
575 0.28
576 0.32
577 0.36
578 0.45
579 0.46
580 0.52
581 0.57
582 0.62
583 0.68
584 0.7
585 0.69
586 0.64
587 0.58
588 0.53
589 0.5
590 0.44
591 0.41
592 0.35
593 0.3
594 0.25
595 0.23
596 0.21
597 0.18
598 0.14
599 0.07
600 0.06
601 0.06
602 0.09
603 0.13
604 0.19
605 0.28
606 0.37
607 0.47
608 0.57
609 0.68
610 0.74
611 0.81
612 0.87
613 0.88
614 0.87
615 0.87
616 0.81
617 0.75
618 0.7
619 0.65
620 0.6
621 0.52
622 0.48
623 0.41
624 0.45
625 0.46
626 0.47
627 0.48
628 0.53
629 0.59
630 0.59
631 0.65
632 0.63
633 0.67
634 0.73
635 0.71
636 0.68
637 0.62
638 0.68
639 0.67
640 0.7
641 0.69
642 0.68
643 0.69
644 0.7
645 0.71
646 0.7
647 0.69
648 0.67
649 0.68
650 0.68
651 0.71
652 0.71
653 0.71
654 0.71
655 0.75
656 0.77
657 0.75
658 0.75
659 0.74
660 0.76
661 0.79
662 0.78
663 0.76
664 0.71
665 0.68