Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XC39

Protein Details
Accession A0A4P9XC39    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
358-377PSRGAKSKARAKPQKPSDQTHydrophilic
NLS Segment(s)
PositionSequence
362-369AKSKARAK
442-481PKRAKPTPAAAPPKSAPSTSAPGRKGSGPAARSGGGSRPK
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019038  POLD3  
IPR041913  POLD3_sf  
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF09507  CDC27  
Amino Acid Sequences MAAAADQLAKLDDLVTASHAPLTYKQVSRQLGLTHVTAKHLLHAYVAAAKKSRSPADLTVLYCITGRLKGSDALAIRVVRAADREATQQQYASGTCHIYAVMASKQPVHPIALTIAYTELIHAEAFDQLGIYRTIRNPAVTFQPRVPDEVAAPPAAVKAHSTGTPGTTSAASTPVLATSASATSKSRETIKSETAVRSFFPTASKAAPSGASAGASPPKPSTTASSFFARSVTAKQKPPAAAAATTTTKAAKVKPEPEPEPAVGAAVSSSEDEEEDAGDAVARREAEEAARERRQRSQAQRQKLMASMVDGSSDSEGDVDAPPAQPRSHHAGADRDEDAPDAEQSEPDVDAMEVDAAPSRGAKSKARAKPQKPSDQTTLNPTVAPASSSETAETRMGADGIMERKRVVRVQKERHVQEGGYLSVQTYSSDEERWEPVTAPAPKRAKPTPAAAPPKSAPSTSAPGRKGSGPAARSGGGSRPKAQSSLASFFGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.11
4 0.12
5 0.14
6 0.14
7 0.15
8 0.17
9 0.24
10 0.28
11 0.3
12 0.35
13 0.42
14 0.45
15 0.45
16 0.45
17 0.4
18 0.38
19 0.37
20 0.33
21 0.31
22 0.29
23 0.3
24 0.29
25 0.27
26 0.28
27 0.28
28 0.26
29 0.21
30 0.2
31 0.19
32 0.23
33 0.25
34 0.22
35 0.22
36 0.23
37 0.27
38 0.32
39 0.34
40 0.3
41 0.33
42 0.35
43 0.4
44 0.44
45 0.4
46 0.38
47 0.34
48 0.32
49 0.27
50 0.24
51 0.18
52 0.16
53 0.16
54 0.14
55 0.15
56 0.17
57 0.18
58 0.21
59 0.21
60 0.2
61 0.23
62 0.21
63 0.19
64 0.19
65 0.19
66 0.15
67 0.15
68 0.15
69 0.14
70 0.15
71 0.2
72 0.23
73 0.26
74 0.26
75 0.24
76 0.23
77 0.23
78 0.22
79 0.19
80 0.17
81 0.15
82 0.14
83 0.14
84 0.13
85 0.11
86 0.11
87 0.12
88 0.12
89 0.14
90 0.14
91 0.17
92 0.18
93 0.21
94 0.22
95 0.2
96 0.18
97 0.17
98 0.18
99 0.16
100 0.15
101 0.13
102 0.12
103 0.1
104 0.1
105 0.09
106 0.07
107 0.06
108 0.06
109 0.05
110 0.05
111 0.06
112 0.06
113 0.05
114 0.05
115 0.05
116 0.06
117 0.07
118 0.08
119 0.1
120 0.11
121 0.16
122 0.17
123 0.19
124 0.18
125 0.2
126 0.29
127 0.3
128 0.32
129 0.29
130 0.35
131 0.33
132 0.35
133 0.34
134 0.25
135 0.22
136 0.23
137 0.23
138 0.17
139 0.16
140 0.13
141 0.13
142 0.12
143 0.1
144 0.07
145 0.08
146 0.09
147 0.1
148 0.12
149 0.11
150 0.13
151 0.13
152 0.13
153 0.12
154 0.11
155 0.1
156 0.09
157 0.1
158 0.09
159 0.08
160 0.08
161 0.07
162 0.07
163 0.07
164 0.06
165 0.06
166 0.07
167 0.07
168 0.08
169 0.09
170 0.1
171 0.12
172 0.13
173 0.17
174 0.18
175 0.23
176 0.26
177 0.29
178 0.31
179 0.33
180 0.34
181 0.31
182 0.29
183 0.24
184 0.24
185 0.22
186 0.18
187 0.17
188 0.15
189 0.15
190 0.16
191 0.16
192 0.13
193 0.12
194 0.12
195 0.11
196 0.11
197 0.09
198 0.08
199 0.08
200 0.08
201 0.11
202 0.11
203 0.11
204 0.1
205 0.11
206 0.12
207 0.13
208 0.16
209 0.17
210 0.2
211 0.21
212 0.24
213 0.24
214 0.23
215 0.22
216 0.19
217 0.15
218 0.17
219 0.23
220 0.25
221 0.28
222 0.29
223 0.33
224 0.33
225 0.33
226 0.31
227 0.24
228 0.19
229 0.17
230 0.18
231 0.15
232 0.14
233 0.14
234 0.11
235 0.11
236 0.12
237 0.13
238 0.16
239 0.2
240 0.25
241 0.32
242 0.38
243 0.39
244 0.41
245 0.42
246 0.36
247 0.32
248 0.27
249 0.2
250 0.13
251 0.11
252 0.07
253 0.04
254 0.05
255 0.04
256 0.04
257 0.03
258 0.04
259 0.04
260 0.04
261 0.04
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.05
268 0.06
269 0.06
270 0.06
271 0.06
272 0.07
273 0.07
274 0.11
275 0.15
276 0.2
277 0.26
278 0.28
279 0.29
280 0.36
281 0.42
282 0.46
283 0.52
284 0.57
285 0.6
286 0.66
287 0.71
288 0.66
289 0.62
290 0.55
291 0.47
292 0.35
293 0.28
294 0.21
295 0.14
296 0.12
297 0.11
298 0.09
299 0.08
300 0.08
301 0.06
302 0.05
303 0.05
304 0.05
305 0.05
306 0.06
307 0.06
308 0.07
309 0.08
310 0.1
311 0.11
312 0.1
313 0.14
314 0.22
315 0.23
316 0.24
317 0.26
318 0.31
319 0.33
320 0.37
321 0.34
322 0.26
323 0.24
324 0.22
325 0.2
326 0.14
327 0.12
328 0.09
329 0.08
330 0.08
331 0.08
332 0.09
333 0.08
334 0.07
335 0.08
336 0.06
337 0.06
338 0.06
339 0.06
340 0.05
341 0.05
342 0.06
343 0.05
344 0.06
345 0.06
346 0.08
347 0.12
348 0.15
349 0.19
350 0.27
351 0.37
352 0.44
353 0.55
354 0.64
355 0.65
356 0.73
357 0.79
358 0.81
359 0.77
360 0.76
361 0.71
362 0.67
363 0.63
364 0.6
365 0.56
366 0.46
367 0.4
368 0.33
369 0.29
370 0.23
371 0.21
372 0.14
373 0.14
374 0.15
375 0.15
376 0.16
377 0.15
378 0.17
379 0.17
380 0.16
381 0.12
382 0.11
383 0.11
384 0.1
385 0.09
386 0.11
387 0.16
388 0.18
389 0.18
390 0.18
391 0.2
392 0.24
393 0.29
394 0.34
395 0.39
396 0.47
397 0.57
398 0.66
399 0.73
400 0.73
401 0.73
402 0.67
403 0.56
404 0.5
405 0.44
406 0.36
407 0.27
408 0.24
409 0.19
410 0.17
411 0.18
412 0.13
413 0.11
414 0.13
415 0.13
416 0.14
417 0.16
418 0.17
419 0.2
420 0.21
421 0.22
422 0.19
423 0.2
424 0.28
425 0.34
426 0.35
427 0.42
428 0.45
429 0.48
430 0.54
431 0.57
432 0.55
433 0.52
434 0.56
435 0.56
436 0.61
437 0.67
438 0.61
439 0.62
440 0.57
441 0.6
442 0.55
443 0.46
444 0.39
445 0.35
446 0.41
447 0.42
448 0.48
449 0.43
450 0.44
451 0.46
452 0.46
453 0.43
454 0.43
455 0.43
456 0.36
457 0.38
458 0.38
459 0.36
460 0.35
461 0.34
462 0.35
463 0.35
464 0.38
465 0.39
466 0.42
467 0.43
468 0.43
469 0.43
470 0.43
471 0.41
472 0.42
473 0.41