FuNGI

A0A4P9XC39

Protein Details

Accession

A0A4P9XC39

Localization Confidence

High

Confidence Score

15.2

NoLS Segment(s)

Position	Sequence	Protein Nature
358-377	PSRGAKSKARAKPQKPSDQT	Hydrophilic

NLS Segment(s)

Position	Sequence
362-369	AKSKARAK
442-481	PKRAKPTPAAAPPKSAPSTSAPGRKGSGPAARSGGGSRPK

Subcellular Location(s)

nucl 21, cyto_nucl 14, cyto 5

Family & Domain DBs

InterPro	View protein in InterPro IPR019038 POLD3 IPR041913 POLD3_sf
Gene Ontology	GO:0043625 C:delta DNA polymerase complex GO:0006260 P:DNA replication
Pfam	View protein in Pfam PF09507 CDC27

Amino Acid Sequences

MAAAADQLAKLDDLVTASHAPLTYKQVSRQLGLTHVTAKHLLHAYVAAAKKSRSPADLTVLYCITGRLKGSDALAIRVVRAADREATQQQYASGTCHIYAVMASKQPVHPIALTIAYTELIHAEAFDQLGIYRTIRNPAVTFQPRVPDEVAAPPAAVKAHSTGTPGTTSAASTPVLATSASATSKSRETIKSETAVRSFFPTASKAAPSGASAGASPPKPSTTASSFFARSVTAKQKPPAAAAATTTTKAAKVKPEPEPEPAVGAAVSSSEDEEEDAGDAVARREAEEAARERRQRSQAQRQKLMASMVDGSSDSEGDVDAPPAQPRSHHAGADRDEDAPDAEQSEPDVDAMEVDAAPSRGAKSKARAKPQKPSDQTTLNPTVAPASSSETAETRMGADGIMERKRVVRVQKERHVQEGGYLSVQTYSSDEERWEPVTAPAPKRAKPTPAAAPPKSAPSTSAPGRKGSGPAARSGGGSRPKAQSSLASFFGKK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.08
2	0.11
3	0.11
4	0.12
5	0.14
6	0.14
7	0.15
8	0.17
9	0.24
10	0.28
11	0.3
12	0.35
13	0.42
14	0.45
15	0.45
16	0.45
17	0.4
18	0.38
19	0.37
20	0.33
21	0.31
22	0.29
23	0.3
24	0.29
25	0.27
26	0.28
27	0.28
28	0.26
29	0.21
30	0.2
31	0.19
32	0.23
33	0.25
34	0.22
35	0.22
36	0.23
37	0.27
38	0.32
39	0.34
40	0.3
41	0.33
42	0.35
43	0.4
44	0.44
45	0.4
46	0.38
47	0.34
48	0.32
49	0.27
50	0.24
51	0.18
52	0.16
53	0.16
54	0.14
55	0.15
56	0.17
57	0.18
58	0.21
59	0.21
60	0.2
61	0.23
62	0.21
63	0.19
64	0.19
65	0.19
66	0.15
67	0.15
68	0.15
69	0.14
70	0.15
71	0.2
72	0.23
73	0.26
74	0.26
75	0.24
76	0.23
77	0.23
78	0.22
79	0.19
80	0.17
81	0.15
82	0.14
83	0.14
84	0.13
85	0.11
86	0.11
87	0.12
88	0.12
89	0.14
90	0.14
91	0.17
92	0.18
93	0.21
94	0.22
95	0.2
96	0.18
97	0.17
98	0.18
99	0.16
100	0.15
101	0.13
102	0.12
103	0.1
104	0.1
105	0.09
106	0.07
107	0.06
108	0.06
109	0.05
110	0.05
111	0.06
112	0.06
113	0.05
114	0.05
115	0.05
116	0.06
117	0.07
118	0.08
119	0.1
120	0.11
121	0.16
122	0.17
123	0.19
124	0.18
125	0.2
126	0.29
127	0.3
128	0.32
129	0.29
130	0.35
131	0.33
132	0.35
133	0.34
134	0.25
135	0.22
136	0.23
137	0.23
138	0.17
139	0.16
140	0.13
141	0.13
142	0.12
143	0.1
144	0.07
145	0.08
146	0.09
147	0.1
148	0.12
149	0.11
150	0.13
151	0.13
152	0.13
153	0.12
154	0.11
155	0.1
156	0.09
157	0.1
158	0.09
159	0.08
160	0.08
161	0.07
162	0.07
163	0.07
164	0.06
165	0.06
166	0.07
167	0.07
168	0.08
169	0.09
170	0.1
171	0.12
172	0.13
173	0.17
174	0.18
175	0.23
176	0.26
177	0.29
178	0.31
179	0.33
180	0.34
181	0.31
182	0.29
183	0.24
184	0.24
185	0.22
186	0.18
187	0.17
188	0.15
189	0.15
190	0.16
191	0.16
192	0.13
193	0.12
194	0.12
195	0.11
196	0.11
197	0.09
198	0.08
199	0.08
200	0.08
201	0.11
202	0.11
203	0.11
204	0.1
205	0.11
206	0.12
207	0.13
208	0.16
209	0.17
210	0.2
211	0.21
212	0.24
213	0.24
214	0.23
215	0.22
216	0.19
217	0.15
218	0.17
219	0.23
220	0.25
221	0.28
222	0.29
223	0.33
224	0.33
225	0.33
226	0.31
227	0.24
228	0.19
229	0.17
230	0.18
231	0.15
232	0.14
233	0.14
234	0.11
235	0.11
236	0.12
237	0.13
238	0.16
239	0.2
240	0.25
241	0.32
242	0.38
243	0.39
244	0.41
245	0.42
246	0.36
247	0.32
248	0.27
249	0.2
250	0.13
251	0.11
252	0.07
253	0.04
254	0.05
255	0.04
256	0.04
257	0.03
258	0.04
259	0.04
260	0.04
261	0.04
262	0.04
263	0.04
264	0.04
265	0.04
266	0.04
267	0.05
268	0.06
269	0.06
270	0.06
271	0.06
272	0.07
273	0.07
274	0.11
275	0.15
276	0.2
277	0.26
278	0.28
279	0.29
280	0.36
281	0.42
282	0.46
283	0.52
284	0.57
285	0.6
286	0.66
287	0.71
288	0.66
289	0.62
290	0.55
291	0.47
292	0.35
293	0.28
294	0.21
295	0.14
296	0.12
297	0.11
298	0.09
299	0.08
300	0.08
301	0.06
302	0.05
303	0.05
304	0.05
305	0.05
306	0.06
307	0.06
308	0.07
309	0.08
310	0.1
311	0.11
312	0.1
313	0.14
314	0.22
315	0.23
316	0.24
317	0.26
318	0.31
319	0.33
320	0.37
321	0.34
322	0.26
323	0.24
324	0.22
325	0.2
326	0.14
327	0.12
328	0.09
329	0.08
330	0.08
331	0.08
332	0.09
333	0.08
334	0.07
335	0.08
336	0.06
337	0.06
338	0.06
339	0.06
340	0.05
341	0.05
342	0.06
343	0.05
344	0.06
345	0.06
346	0.08
347	0.12
348	0.15
349	0.19
350	0.27
351	0.37
352	0.44
353	0.55
354	0.64
355	0.65
356	0.73
357	0.79
358	0.81
359	0.77
360	0.76
361	0.71
362	0.67
363	0.63
364	0.6
365	0.56
366	0.46
367	0.4
368	0.33
369	0.29
370	0.23
371	0.21
372	0.14
373	0.14
374	0.15
375	0.15
376	0.16
377	0.15
378	0.17
379	0.17
380	0.16
381	0.12
382	0.11
383	0.11
384	0.1
385	0.09
386	0.11
387	0.16
388	0.18
389	0.18
390	0.18
391	0.2
392	0.24
393	0.29
394	0.34
395	0.39
396	0.47
397	0.57
398	0.66
399	0.73
400	0.73
401	0.73
402	0.67
403	0.56
404	0.5
405	0.44
406	0.36
407	0.27
408	0.24
409	0.19
410	0.17
411	0.18
412	0.13
413	0.11
414	0.13
415	0.13
416	0.14
417	0.16
418	0.17
419	0.2
420	0.21
421	0.22
422	0.19
423	0.2
424	0.28
425	0.34
426	0.35
427	0.42
428	0.45
429	0.48
430	0.54
431	0.57
432	0.55
433	0.52
434	0.56
435	0.56
436	0.61
437	0.67
438	0.61
439	0.62
440	0.57
441	0.6
442	0.55
443	0.46
444	0.39
445	0.35
446	0.41
447	0.42
448	0.48
449	0.43
450	0.44
451	0.46
452	0.46
453	0.43
454	0.43
455	0.43
456	0.36
457	0.38
458	0.38
459	0.36
460	0.35
461	0.34
462	0.35
463	0.35
464	0.38
465	0.39
466	0.42
467	0.43
468	0.43
469	0.43
470	0.43
471	0.41
472	0.42
473	0.41

A0A4P9XC39

3D AlphaFold-predicted Structure Viewer